Rhopilema esculentum: 135683573 Help Entry 135683573         CDS       T09994                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism res  Rhopilema esculentum Pathway res04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:res00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     135683573  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:res04121]     135683573    03400 DNA repair and recombination proteins [BR:res03400]     135683573 Ubiquitin system [BR:res04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      135683573    Cul5 complex      135683573 DNA repair and recombination proteins [BR:res03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      135683573 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  135683573 NCBI-ProteinID:  XP_065054944 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MEVFIIVKRKNLTMFLDGKMTTTVFEVKKMIQGITKKLPEDQRLLLLQENREMEDNKTLA DYGLTSQVAKAQTPALLAVTYKNEDGQFEEVDFTPLSQPPDPPEALKQPDSSIMSQHKS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggaggtatttattatagtgaaaagaaagaacttaaccatgtttcttgatggtaaaatg accacaacggtgtttgaagttaagaaaatgatccaaggcatcactaaaaagctacctgaa gaccaaaggctattgctgttacaagaaaacagagaaatggaagacaataaaacattggca gattatggtcttactagtcaagtagcaaaagcccagactccggcacttctggctgtcact tacaagaatgaagatgggcagtttgaagaagttgattttacacctctgtcacaaccacca gacccaccagaggcattgaaacaacctgattcctcgattatgtcacaacacaagtcatag

DBGET integrated database retrieval system