Rhopilema esculentum: 135692385 Help Entry 135692385         CDS       T09994                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism res  Rhopilema esculentum Pathway res04081   Hormone signaling res04144   Endocytosis res04150   mTOR signaling pathway res04310   Wnt signaling pathway res04350   TGF-beta signaling pathway res05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:res00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     135692385    04350 TGF-beta signaling pathway     135692385    04150 mTOR signaling pathway     135692385   09133 Signaling molecules and interaction    04081 Hormone signaling     135692385  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     135692385  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     135692385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:res04131]     135692385   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:res04147]     135692385    04031 GTP-binding proteins [BR:res04031]     135692385 Membrane trafficking [BR:res04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     135692385 Exosome [BR:res04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135692385   Exosomal proteins of other body fluids (saliva and urine)    135692385   Exosomal proteins of colorectal cancer cells    135692385   Exosomal proteins of bladder cancer cells    135692385 GTP-binding proteins [BR:res04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     135692385 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  135692385 NCBI-ProteinID:  XP_065066546 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDAPDSLDNIPEKWTPEVKHFCPNVPIILVGNKKD IRNDEAIKRELTRMKQEPVKPEQGKVMADNIGAFAYLECSAKTKEGVREVFEMATRAALQ VKKKKTKRCILL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggccgctatcagaaagaaattagtaattgttggtgatggtgcttgtggtaaaacctgt ctcctgattgtattctcaaaggaccagtttccagaagtttatgtcccaactgtatttgag aattatgttgcagacattgaagtagatggaaagcaagttgaattggcattgtgggataca gctggacaagaagactatgatagactgaggccactgtcatatccagacactgatgttatt ctcatgtgcttttcaattgatgcaccagactccctagataatatcccagaaaaatggact ccagaggtaaaacatttttgcccaaatgtgccaataatccttgtgggtaacaagaaagat atcaggaatgatgaagccattaagagggagttaacacgtatgaagcaggagccagttaaa cctgaacaaggcaaggtaatggcagataacataggtgcttttgcatatctggaatgctct gccaagacaaaagaaggtgtgagagaggtctttgaaatggcaacaagggcagctttgcaa gtgaaaaagaagaaaactaagcgttgtatcctgctgtag

DBGET integrated database retrieval system