KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0448
Entry
Reut_A0448        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00281  Geraniol degradation
reu00362  Benzoate degradation
reu00592  alpha-Linolenic acid metabolism
reu00642  Ethylbenzene degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01212  Fatty acid metabolism
Module
reu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A0448
   00592 alpha-Linolenic acid metabolism
    Reut_A0448
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A0448
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Reut_A0448
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A0448
   00642 Ethylbenzene degradation
    Reut_A0448
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Reut_A0448
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III DUF5708
Other DBs
NCBI-ProteinID: AAZ59830
UniProt: Q475V3
LinkDB
Position
1:494078..495274
AA seq 398 aa
MKQLQDAYIVAATRSPIGKAPKGAFKNTRPDDLLATILKAAVAQVPNLDPKLIEDAIVGC
AIPEAQQGLNVARIGALLSGLPNTVGGITVNRFCASGVSAVAMAADRIRVGESDVMIAAG
VETMSMVPMMGNSPSMSPDIFTRDENVGIAYGMGLTAEKVAQQWNVSREDQDAFSLASHQ
KAIAAQQAGEFNDEITPIEIVEKFPNLATGEVSVKTRTISLDEGPRPETSLEGLGKLRPV
FANKGSVTAGNSSQTSDGAGALILVSEKILKQFNLVPLARFVSFAVRGVPPEIMGIGPKE
AIPAVLKAAGLTQDQIDWIELNEAFAAQSLAVMRDLELDPSKVNRMGGAIALGHPLGATG
AIRSATVVHALRRHNLKYGMVTMCVGTGMGAAGIFERV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaaacaactgcaagacgcctacatcgttgccgcgactcgctctccgatcggcaaggcg
ccgaagggcgcgttcaagaacacgcgtccggacgacctgctcgcgacgatcctgaaagcc
gccgtggcgcaggtgccgaacctcgatccgaagctgatcgaagatgccatcgtcggctgc
gcgattcccgaagcgcagcagggcctgaacgtggcgcgtatcggcgcgctgctgtcgggc
ctgccgaacacggtgggcggcatcaccgtcaaccgcttctgcgcctccggcgtgagtgcc
gtggcgatggccgcggaccgcatccgcgtgggcgagtccgacgtgatgatcgccgccggc
gtggaaacgatgagcatggtgccgatgatgggcaactcgccgtcgatgtcgccggacatc
ttcacgcgggacgaaaacgttggcatcgcgtacggcatgggcctgaccgccgagaaggtc
gctcagcaatggaatgtcagccgtgaggaccaggatgcgttttcgctggcttcgcaccag
aaggccatcgctgcccagcaggccggcgagttcaacgacgagatcacgccgatcgaaatc
gtcgagaaattcccgaacctggctacgggagaggtgagcgtcaagacgcgcacgatctcg
ctcgacgaaggcccgcgcccggagacctcgctcgaaggccttggcaagctgcgcccggtg
ttcgcaaacaagggtagcgtgaccgccggcaacagctcgcagacgtccgacggcgccggc
gcgctgatcctggtctccgagaagatcctgaagcagttcaacctggtgccgctcgcacgc
ttcgtgtcgttcgcggtgcgcggcgtgccgccggagatcatgggtatcggcccgaaggaa
gcgattcctgcggtgttgaaggcagccgggctgacgcaggaccagatcgactggatcgaa
ctgaacgaagcgtttgccgcgcaatcgctggccgtgatgcgtgatcttgaactcgacccg
tccaaggtcaaccgcatgggcggtgccattgcgctcggccacccgctcggcgcgacgggc
gcgatccgctcggcgactgtggtgcacgcgctgcgtcgccacaacctgaagtacggcatg
gtgaccatgtgcgtcggtacgggcatgggcgcggccggcatctttgagcgcgtctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1669
Entry
Reut_A1669        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00281  Geraniol degradation
reu00362  Benzoate degradation
reu00592  alpha-Linolenic acid metabolism
reu00642  Ethylbenzene degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01212  Fatty acid metabolism
Module
reu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1669
   00592 alpha-Linolenic acid metabolism
    Reut_A1669
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1669
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Reut_A1669
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1669
   00642 Ethylbenzene degradation
    Reut_A1669
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Reut_A1669
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Other DBs
NCBI-ProteinID: AAZ61035
UniProt: Q470Z8
LinkDB
Position
1:complement(1801047..1802225)
AA seq 392 aa
MQQAVIVDAIRSPMGRSKPGSAFTELHATELLAQVLKGLVERNKLDPGLVDDVITGCVTQ
AGEQSAGPGRVAWLAAGFPDHVPATTIDRKCGSSQQAVHFAAQGIMAGAYDIVIACGIES
MSRVPMGSARIGQNPYGPSMEARYAPGLVSQGVAAELVAAKYELSRAQMDGYSARSHELA
AAAREAGAFRREILPIVTPNGVIEHDETIRPGTSVEKLGTLQASFRNDELSARFPQIGWN
VTAGNASQISDGASAMLLMSESMAQRLGLKPRARFVAFDVCGDDPVMMLTAPIPASQRAI
KKSGLKLDQIDHYEINEAFACVPLAWQKALGADAARLNPRGGAIALGHPLGASGVRLMTT
MLHALEDSGGRYGLQSMCEAGGMANATIIERL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcaacaagccgtcatcgtcgacgccatccgcagcccgatgggccgctccaagcccggt
tcggctttcaccgaactgcatgccacggaactgctggcccaggtgctcaagggcctggtg
gagcgcaacaagctggatccgggtctcgtcgacgacgtcatcaccggctgcgtcacgcag
gccggcgaacagtccgccggccccggccgcgtggcctggctggcggctggcttccctgac
catgtgcccgccaccacgatcgaccgcaagtgcggttcgagccagcaggccgtgcatttc
gccgcgcagggcatcatggccggcgcctatgacatcgtcatcgcctgcggcatcgagtcg
atgagccgcgtgccgatgggttcggcccgtatcggccagaacccctatggcccgtcgatg
gaagcgcgttacgcgccgggtctggtctcgcagggcgtggcagcggaactggttgccgcc
aagtacgaactgtcccgcgcgcagatggacggctactcggctcgttcgcacgaactggcc
gctgccgcacgcgaagccggtgcattccgccgcgagatcctgccgatcgtgacgccgaat
ggcgtgatcgagcacgacgagaccatccgcccgggcacttcggtcgaaaagcttggcacg
ctgcaggcctcgttccgcaatgacgagctgagcgcgcgtttcccgcagatcggctggaac
gtgacggccggcaatgcatcgcagatcagcgacggcgcctcggccatgcttctgatgagc
gaatccatggcgcagcgcctgggcctgaagccgcgtgcgcgtttcgtggccttcgacgtg
tgtggcgacgatccggtgatgatgctgaccgcaccgatcccggccagccagcgcgccatc
aagaagagcggcctcaagctcgatcagatcgaccactacgaaatcaatgaagcgttcgct
tgcgtgccgttggcctggcagaaggcgcttggcgccgacgcggcgcggctgaacccgcgt
ggtggtgcgattgcgctgggccacccgctcggtgcatcgggcgtgcgcctgatgaccacc
atgctccacgcattggaggacagcggcggccgctacggcctgcaatcgatgtgcgaagcc
ggcggcatggccaacgccacgatcatcgaacgtctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5587
Entry
Reut_B5587        CDS       T00268                                 
Name
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00281  Geraniol degradation
reu00362  Benzoate degradation
reu00592  alpha-Linolenic acid metabolism
reu00642  Ethylbenzene degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01212  Fatty acid metabolism
Module
reu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_B5587
   00592 alpha-Linolenic acid metabolism
    Reut_B5587
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_B5587
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Reut_B5587
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5587
   00642 Ethylbenzene degradation
    Reut_B5587
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Reut_B5587
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: AAZ64932
UniProt: Q46PK2
LinkDB
Position
2:2404863..2406065
AA seq 400 aa
MTEAFICDAIRTPIGRYGGSLSAVRADDLGAVPLKALMARNPNVDWKAVDDVIYGNANQA
GEDNRNVARMSSLLAGLPQDVPGATINRLCGSGMDAIGTAARAIKAGEATLMIAGGVESM
SRAPFVMGKATSAFSRDAQIFDTTIGWRFINPAMRAAYGVDSMPETAENVATDYKISRED
QDLMALRSQEKASRAQADGTLAQEITAVTIAQKKGDPIIVERDEHPRATSMEALGKLRGV
VRADGTVTAGNASGVNDGACAILLASEAGIKQHGLTPRARIVGMATAGVAPRVMGIGPAP
ATQKLMKQLGMTLDQIDVIELNEAFAAQGLAVLRELGIADDDKRVNPNGGAIALGHPLGM
SGARLVTTAMYQLHRTGGRFALCTMCIGVGQGIAMVIERV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaccgaagcctttatctgcgacgccatccgtacccccatcggccgttacggcggcagc
ctgtccgcggtacgcgcggacgacctgggcgcggtgcccctgaaggcgctgatggcgcgc
aatccgaacgtggactggaaagccgtcgacgacgtgatctacggtaatgccaaccaggcc
ggcgaagataaccgcaacgtggcacgcatgtcgtcgctgctggccggtctgccgcaggac
gtgccgggtgccaccatcaaccgcctgtgcggttccggcatggacgcaatcggcacggcc
gcgcgcgccatcaaggccggcgaagcgaccctgatgatcgccggcggcgtggaaagcatg
agccgcgctccgttcgtgatgggcaaggccaccagcgcgttctcgcgcgatgcgcagatc
ttcgacaccacgatcggctggcgcttcatcaacccggcgatgcgggctgcgtatggcgtt
gactcgatgcccgagaccgccgagaacgtcgcgaccgactacaagatcagccgcgaagac
caggatctgatggcgctgcgcagccaggaaaaggcctcgcgcgcacaggccgacggtacg
ctggcccaggaaatcaccgcagtgacgatcgcccagaagaagggcgacccgatcatcgtc
gagcgtgacgagcatccgcgtgcgaccagcatggaagcgctgggcaagctgcgcggcgtg
gtccgtgctgacggcaccgtgactgccggcaatgcatcgggcgtgaacgacggcgcctgc
gcgatcctgctcgcgagcgaagccggcatcaagcaacacggcctgaccccgcgtgcgcgc
atcgtcggtatggcaacggctggcgtggcaccgcgtgtgatgggcatcggcccggcaccg
gccacgcagaagctgatgaagcagctcggcatgacgctggatcagatcgacgtgatcgaa
ctgaacgaagcgttcgccgcgcaaggcctggccgtgctgcgcgaactgggcatcgccgac
gacgacaagcgcgtcaacccgaacggcggcgcgatcgcgctgggccacccgctcggcatg
agcggcgcgcgtctggtgaccaccgcgatgtaccagctgcatcgcaccggcggccgcttc
gcgctgtgcacgatgtgcatcggcgtgggccagggtatcgccatggtgatcgaacgcgtc
tga

DBGET integrated database retrieval system