Cupriavidus pinatubonensis JMP134: Reut_A0488 Help Entry Reut_A0488        CDS       T00268                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism reu  Cupriavidus pinatubonensis JMP134 Brite KEGG Orthology (KO) [BR:reu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:reu03000]     Reut_A0488    03036 Chromosome and associated proteins [BR:reu03036]     Reut_A0488    03400 DNA repair and recombination proteins [BR:reu03400]     Reut_A0488 Transcription factors [BR:reu03000]  Prokaryotic type   Helix-turn-helix    Other families     Reut_A0488 Chromosome and associated proteins [BR:reu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Reut_A0488 DNA repair and recombination proteins [BR:reu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       Reut_A0488 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 Fis_N Motif Other DBs NCBI-ProteinID:  AAZ59870 LinkDB All DBs Position 1:complement(531465..531698) Genome browser AA seq 77 aa AA seqDB search MSRNAIDQCIRDSLDSYFRDLDGEEPSNMYNMVLEAVERPLLEAVMVRAERNQSLAAAYL GINRNTLRKKLQLHGLL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagccgcaacgctatcgaccagtgcatccgggacagcctggatagttactttcgggat ctggacggcgaagagccttccaatatgtacaacatggtgctggaggccgtcgagcgcccg ctgctcgaagccgtgatggtgcgcgccgagcgcaaccagtcgctggccgccgcctacctc ggcatcaatcgcaatacgctgcgcaagaagttgcagctgcacggtttactttga

DBGET integrated database retrieval system