KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1327
Entry
Reut_A1327        CDS       T00268                                 
Name
(GenBank) benzoate-CoA ligase
  KO
K04110  benzoate-CoA ligase [EC:6.2.1.25]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00627  Aminobenzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1327
   00627 Aminobenzoate degradation
    Reut_A1327
Enzymes [BR:reu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.25  benzoate---CoA ligase
     Reut_A1327
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AAZ60697
UniProt: Q472I6
LinkDB
Position
1:1423044..1424705
AA seq 553 aa
MTPPNTAAGSPAGASLSSGTAESDITALPARYNAAADLLGRNLAAGRGDKVAYVDDKVSL
TFSELDARARRFAAALHDAGFRREERLLLCAFDTVDFPTVFLGCLLAGVVPVAVNTLLTT
DDYAYMLQHSGARAVVVSEALLPLMKTAVASSGLSPVVIQAAPYKDAAPSCSVEAVISRT
RSAAPVVDTGPDDMAFWLYSSGSTGRPKGTVHTHGNLFHTADLYARRVLGMREDDVVFSA
AKLFFAYGLGNALTFPLFVGATTVLMAERPTPAAVFRRLCEHRPTVFCGVPTLFAGMLAS
PELPPRSDVAMRVCTSAGEALPRDIGERFFAHFGCDILDGIGSTEMLHIFLSNRPGDVRY
GTTGKPVPGYELKLLDELGEPGKPGEIGDLYIKGPSAALMYWCNRDKTRDTFVGAWTRSG
DKYLQDADGYYIYAGRSDDMLKVGGIYVSPFEVEAALALHSSVLEAAVIGVVDADELVKP
KAFVVMRPGQQWHAGMAAELQAFVKSRLAPYKYPRQIECVEELPKTATGKIQRFRLRQRE
EAARAAATAHADA
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgacgccccccaataccgctgccggttcgccggcgggtgcttcgctttcgtccggaact
gccgaatccgatatcaccgcgctgcccgcccggtacaacgctgccgccgacttgctgggg
cgcaacctcgcggcgggtcgcggcgacaaagttgcctatgtcgacgacaaggtctcgcta
actttctctgaactcgatgcgcgcgctcgccgctttgccgcggcgctgcatgacgcgggt
ttccggcgcgaggaacgtctgctgctgtgcgcgttcgataccgtcgactttccaaccgta
ttcctcggctgcctgcttgcgggcgtggtgccggtcgcggtgaatacgctgctcacgacc
gacgactacgcgtacatgctccagcacagtggtgcgcgtgccgtggtggtgtctgaggcg
ctgcttcccctcatgaagaccgcggtcgccagcagcggcctgtcgccggtggtcattcag
gcagccccgtacaaggatgcggcgccaagctgcagtgtggaggcagtgatctcgcgcacg
cgctcggcggcgccggtggtcgacaccgggccggacgacatggcgttctggctctattcg
tcgggctcgacgggccgccccaagggcactgtgcatacgcacggcaacctcttccatacc
gctgacctgtacgcgcggcgcgtgctcggcatgcgtgaagacgatgtggtgttctcggcg
gcgaagctgttctttgcctatggactcggcaatgcgctgacgtttccgctgttcgtgggc
gccaccacagtgctgatggcggaacggcccacgccggccgcggtgttccggcggctgtgc
gagcatcgtcccactgtgttctgcggtgtgccgacgctgtttgcaggcatgctcgcctcg
cccgaactgccaccgcgcagcgacgtggcaatgcgcgtctgcacctcggctggcgaggcc
ttgccgagggatatcggcgaacggttcttcgcccatttcggctgcgacattcttgatggc
atcggctctaccgaaatgctgcacatcttcctgtcgaaccggcccggcgacgtacgctat
ggcacgacgggcaagccggtgcccggctatgaactgaagctgctcgacgagcttggcgaa
cccggcaagccaggcgagatcggagacctgtacatcaaagggccatcggccgcgctgatg
tactggtgcaatcgcgacaagacccgcgacaccttcgtcggcgcatggacgcgcagtggc
gacaagtacctgcaggatgcggacgggtactacatctacgccgggcgcagcgatgacatg
ctcaaagtgggcggcatctatgtctcgccgttcgaggtcgaggccgcgctcgcactgcac
tcgtccgtgcttgaggctgcggtgatcggcgtggtcgatgccgacgaactcgtcaagccg
aaagccttcgtcgtaatgcgtccgggacagcagtggcacgcgggcatggctgccgagttg
caggccttcgtcaagtcacgacttgcgccgtacaagtatccacggcagatcgagtgcgtg
gaggaattgccgaagaccgctacgggcaagattcagcgcttccgcctgcgccagcgcgag
gaagcagcgcgtgcggccgcaacggcccacgccgatgcctga

DBGET integrated database retrieval system