KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1705
Entry
Reut_A1705        CDS       T00268                                 
Name
(GenBank) Catechol dioxygenase, N-terminal
  KO
K03381  catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1705
   00364 Fluorobenzoate degradation
    Reut_A1705
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1705
   00623 Toluene degradation
    Reut_A1705
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Reut_A1705
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg CarbopepD_reg_2 DUF4198 Big_1
Other DBs
NCBI-ProteinID: AAZ61070
UniProt: Q470W3
LinkDB
Position
1:1839703..1840620
AA seq 305 aa
MDKIAIDTVLNRIEETTGQNANPRITTIVHRMVRDLFYMIEDLDIQPEEFWAGLNYLAEA
GRSGELGLIAPGLGFDHFLDLRMDEAEARAGIAGGTPRTIEGPLYVAGAPVAQGEARLDD
GTDDGEVLVMEGQVFDNAGKPLPGANVEVWHANSMGNYSYFDPTQSAFNLRRTIVTDSEG
RYRLRSIVPVGYSVPPNGATDRLLKQLDRHGTRPAHIHFFVSAPGHRKLTTQINIDGDPY
LWDDFAFATREGLVPPVTRVEDAAALQALGVDKPFSLIRFNFTLHADRADAPQAEVARQR
AAVTA
NT seq 918 nt   +upstreamnt  +downstreamnt
atggacaagatcgccatcgacaccgtgctcaaccgcatcgaggaaaccacgggccagaac
gccaacccacgtatcactaccatcgtgcaccggatggtgcgcgaccttttttacatgatc
gaggacctcgacatccagcccgaggagttctgggccggcctcaactacctggccgaggct
ggccgcagcggcgaactgggcctgatcgctccaggacttggctttgaccacttcctggac
ctgcgcatggacgaggccgaggcgcgcgcgggcatcgcaggcggcacgccgcgtaccatc
gaaggcccgctgtacgtggccggcgcaccggttgcacaaggtgaagcccggcttgacgac
ggcaccgacgacggcgaggtgctggtgatggaagggcaggtattcgacaacgccggcaag
ccgctgcccggcgcgaacgtggaagtctggcacgcgaattcgatgggcaactactcgtac
ttcgatccgacccagagtgcgttcaacctgcgccgtaccatcgtgaccgacagtgaaggg
cgctaccgcctgcgcagcattgttccggtcggctacagcgtgccgccgaatggggccacc
gaccgcctgctgaagcagctcgaccgacacggcacgcggccggcccacatccacttcttc
gtgtcggcacccggtcaccgcaagctgaccacgcagatcaacatcgatggcgatccgtac
ctgtgggatgacttcgcgttcgccacgcgcgaagggctggtgccaccggtgacacgcgtc
gaggacgctgcagcactgcaggcgctgggcgtcgacaagccgttctcactgatccggttc
aacttcacgctgcatgccgacagggccgatgcaccgcaggcggaggtcgcgcgtcagcgc
gcggccgtgacagcctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4402
Entry
Reut_B4402        CDS       T00268                                 
Name
(GenBank) Catechol dioxygenase, N-terminal
  KO
K03381  catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4402
   00364 Fluorobenzoate degradation
    Reut_B4402
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B4402
   00623 Toluene degradation
    Reut_B4402
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Reut_B4402
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg DUF4198 Big_1 SpaA
Other DBs
NCBI-ProteinID: AAZ63754
UniProt: Q46SY0
LinkDB
Position
2:1059617..1060540
AA seq 307 aa
MTHAEIEALAKQFIVDTATQGTANARVQQVVLRLTTDLFKAIEDLDLSQSEVWKGIEYMA
EAGATQELGLLAAGLGLERFLDVRADEADAKAGISGGTPRTIEGPLYVAGAPESKGFARL
DDGSEADKGEVLFMQGTVYDGEGKPLPGAKVEVWHANLMGNYSFFDKTQSHFNLRRTIVT
DDKGRYQFRSNVPMGYGCPPQGTTQRLLDQLARHGRRPAHIHFFVSAPGHRKLTTQINID
GDEYLWDDFAFASREGLVPAVTRVSDPAALDKHGVDKPFASIDFDFRLNNERDNAPSAEV
ERTRAAA
NT seq 924 nt   +upstreamnt  +downstreamnt
atgacgcatgcagagatcgaggcactggccaagcaattcatcgtcgataccgccacgcag
ggcaccgcgaacgcacgtgtgcagcaggtcgtgctgcgcctgaccaccgacctgttcaag
gccatcgaagacctcgacctgagccagagcgaagtgtggaagggtatcgagtacatggcc
gaggccggcgccacgcaggaactgggtctgcttgcggcaggattgggtctggaacgcttc
ctggacgtccgtgcagacgaggccgacgccaaggccggtatctccggcggcaccccgcgc
accatcgaaggcccgctgtacgtggccggcgcaccggaaagcaagggcttcgcccgcctg
gacgacggcagcgaagccgacaagggtgaagtgctgttcatgcagggcaccgtctatgac
ggcgaaggcaagccgctgccgggcgccaaggtcgaggtgtggcacgccaacctgatgggc
aactactcgttcttcgacaagacgcagtcgcacttcaacctgcgccggaccatcgtcacc
gacgacaagggccgctaccagttccgcagcaatgtgccgatgggctatggctgcccgccg
caaggcaccacgcagcgcctgttggaccaactggcgcgccacggccgccgtcccgcgcac
atccacttcttcgtgtccgcgccgggccaccgcaagctgaccacgcaaatcaacatcgac
ggcgacgagtacctgtgggacgacttcgcgttcgccagccgtgaaggcctggtgccggcc
gtgacccgcgtgagcgacccggcagcactggacaagcatggcgtggacaagccgttcgcc
tcgatcgacttcgacttccgcctgaacaacgagcgcgacaacgcgccttcggccgaagtc
gagcgcacccgcgctgccgcctga

DBGET integrated database retrieval system