KEGG   Cupriavidus pinatubonensis JMP134: Reut_A2179
Entry
Reut_A2179        CDS       T00268                                 
Name
(GenBank) Thioesterase superfamily
  KO
K01075  4-hydroxybenzoyl-CoA thioesterase [EC:3.1.2.23]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00130  Ubiquinone and other terpenoid-quinone biosynthesis
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Reut_A2179
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A2179
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.23  4-hydroxybenzoyl-CoA thioesterase
     Reut_A2179
SSDB
Motif
Pfam: 4HBT_2 4HBT 4HBT_3
Other DBs
NCBI-ProteinID: AAZ61543
UniProt: Q46Z90
Structure
LinkDB
Position
1:complement(2404107..2404556)
AA seq 149 aa
MTAVFRNTVLVRFKHCDAAGIVFYPRYFEMLNDFIEDWFAQALDWPFDAMHGAGQAGVPT
ADLHCRFVAPSRLGETLTRELRVVKLGQSSFTVQVRFMGPDSGLRLEVTQRLVCVDTDKI
APRPLPDPVRQAMATYVDETLAATGSPGL
NT seq 450 nt   +upstreamnt  +downstreamnt
atgactgccgtattccgcaataccgtgctggtgcgcttcaagcactgtgacgccgccggc
atcgtgttctatccgcgctacttcgagatgctcaacgacttcatcgaggactggttcgct
caagcgctggactggcccttcgatgccatgcatggcgccggacaggctggcgtgccgacc
gccgacctgcactgccgctttgtcgcgccgagccgcctcggggagacgctcacacgggag
cttcgcgtggtcaagctcgggcagtccagcttcacagtgcaggtacggttcatgggcccc
gacagtggcttgcggctggaagtgacgcagcggctggtctgcgtcgatacggacaagatc
gcgccacggccgctgccggatcccgtgcgacaggcgatggcgacctacgtggatgagact
ctggcggcaactggcagcccgggcctctga

DBGET integrated database retrieval system