KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3917
Entry
Reut_B3917        CDS       T00268                                 
Name
(GenBank) Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region:Acyl-CoA dehydrogenase, N-terminal
  KO
K04117  cyclohexanecarboxyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B3917
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-
     Reut_B3917
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: AAZ63274
UniProt: Q46UB0
LinkDB
Position
2:548409..549560
AA seq 383 aa
MNPYLNEDLQALAEHARRFADACIAPGFLERDKTRVLDRSLMRQMGEMGFIGPELPEAYG
GQGMGCLAAGVIHEAVARADLSMSYVNLLASLNGQILAQHALPEVGRPWLQRLTRGEALF
AIALTEPRGGSDAGSLRLRMERVGDSYVLNGEKTSISAADQADAAVVFARTGSVEDGARG
ISAVLVPMDLPGVTRNRFDCHGQRAIGRGSIFFENVRVPADHLLGTEGQGFVQVMQGFDF
SRALIGLQVLAVAQAALDETWEYVAERQAFGKPLSAFQGVSHPLADFETQVTAARLLCLQ
TLWLKDHGLPHTSEAAMCKWWAPKLAYDVVHQCLLSFGHGGYDRGVMEQRLRDVLGFQIG
DGTAQIMKTIIARHRAGRAAVPA
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaatccctacctcaacgaagacctgcaggcgctggccgagcatgcgcgccggtttgcc
gatgcgtgcatcgcacccggtttcctggagcgcgacaagacgcgcgtgctggaccgctcg
ctgatgcggcagatgggcgagatgggcttcatcggccccgagctgcccgaagcgtacggc
gggcagggcatgggttgcctggccgccggcgtgatccatgaagcggttgcgcgtgcggac
ctgagcatgtcgtatgtcaacctgctggcgtcgctgaacggtcagatcctcgcgcagcat
gccttgcctgaagtggggaggccgtggctgcagcgcctcacccggggcgaggcgctgttc
gcaattgcgctgaccgagccgcgcggcggatcggacgcgggcagcctgcggctgcgcatg
gaacgcgtcggcgacagttacgtgctcaacggcgagaagacgtcgatttcggcagccgac
caggccgacgccgcggtcgtgtttgcgcgtacgggaagcgtcgaggacggcgcgcgcggc
atttccgccgtgctggtgccgatggatctgcccggcgtgacgcgcaaccgctttgattgc
cacggccagcgcgcgatcgggcgcggctcgatcttcttcgagaacgtgcgcgtgccggcg
gaccatctgctgggcacggaaggtcagggctttgtgcaggtgatgcagggtttcgatttc
tcacgtgcgctgatcgggttgcaggtcctggcggtggcgcaggcagcgctcgatgagacg
tgggaatacgtggccgaacgccaggcattcggcaagccgctgtcggcgttccagggcgta
tcgcatccgcttgcggatttcgagacgcaggtcaccgcagcgcgcctgctttgcctgcag
acgctctggctcaaggaccacggcctgccgcatacgtccgaggctgccatgtgcaagtgg
tgggcaccgaagctggcgtacgacgtggtgcaccagtgcctgctgtccttcgggcatggc
ggctatgaccgcggcgtgatggagcagcgactgcgcgatgtgctgggcttccagatcggc
gacggcacggcccagatcatgaagaccatcatcgcgcgccaccgtgccgggcgcgctgcg
gtgccggcctga

DBGET integrated database retrieval system