KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4406
Entry
Reut_B4406        CDS       T00268                                 
Name
(GenBank) 1,2-dihydroxycyclohexa-3,5-diene-1-carboxylate dehydrogenase
  KO
K05783  dihydroxycyclohexadiene carboxylate dehydrogenase [EC:1.3.1.25 1.3.1.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00551  Benzoate degradation, benzoate => catechol / methylbenzoate => methylcatechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4406
   00364 Fluorobenzoate degradation
    Reut_B4406
   00622 Xylene degradation
    Reut_B4406
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.25  1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase
     Reut_B4406
    1.3.1.-
     Reut_B4406
SSDB
Motif
Pfam: adh_short adh_short_C2 KR PilM_2
Other DBs
NCBI-ProteinID: AAZ63758
UniProt: Q46SX6
LinkDB
Position
2:1063611..1064396
AA seq 261 aa
MSTSNRFEGKIVVITGAAQGIGRGVALRAAAEGAILVLADRSELVHEVVAEIAAQDGRAT
AVIVDLETYAGARAMIDTALSAHGRVDVLINNVGGTIWAKPYQHYEAEQIEAEIRRSLFP
TLWSCRAALPGMVERRQGTIVNVSSIATRSIHRVPYAAAKGGVNALTASLAFEHAGEGIR
VNAVATGGTEAPPRRIPRNTSEQTPQEAEWYQGIVDQTIGSSLMHRYGTIDEQVGAILFL
ASDEASYITGTVLPVGGGDQG
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagcacttccaatcgttttgaaggcaagatcgtcgtcatcaccggcgcggcacagggc
atcggccgcggcgtggcgctgcgcgcagcggccgagggagccatcctcgtgctcgctgac
cggtcggaactcgtccatgaggttgtggccgaaattgccgcgcaggacggccgcgccacg
gcggtgatcgtcgacctggaaacctatgccggcgccagggccatgatcgatacggcactc
tctgcgcacggtcgtgtcgacgtgctcatcaacaatgtcggcggcaccatctgggccaag
ccttaccagcactacgaagcagagcagatcgaagccgagatccgccgctcgctgttcccc
acgctgtggagctgccgcgcggcgctgcccggcatggtcgagcggcgccagggcacaatc
gtcaatgtgtcgtcgatcgctacacgcagtatccaccgcgtgccgtatgccgcggccaag
ggcggcgtcaatgcgctgactgctagccttgcgttcgaacacgccggcgaaggtatccgc
gtcaatgcggtcgcgaccggcggcacggaagccccgccgcgccgcatcccgcgcaatacg
tccgagcaaacgccgcaggaagccgagtggtaccagggcatcgtcgatcagaccatcggc
tcgagcctgatgcaccgctacggcaccatcgacgagcaggtcggcgcgatcctgttcctg
gcgtcggacgaggcgtcctacattaccgggacggtgctgccggttggtggcggagatcag
ggctaa

DBGET integrated database retrieval system