KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4559
Entry
Reut_B4559        CDS       T00268                                 
Name
(GenBank) Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region
  KO
K04118  pimeloyl-CoA dehydrogenase [EC:1.3.1.62]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4559
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.62  pimeloyl-CoA dehydrogenase
     Reut_B4559
SSDB
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_1
Other DBs
NCBI-ProteinID: AAZ63909
UniProt: Q46SH5
LinkDB
Position
2:complement(1237588..1238736)
AA seq 382 aa
MDLFYSDEHKAFRQEVRDFIAANLPDDMRERLRAGGFASKTDTERWQRALNRRGWGAPAW
PTAFGGAGWDAAKQQIFADECAAAPAPPPHIFNITMLGPVIIHFGSDAQREYFLPKLLNA
DIQVCQGFSEPGSGSDLASLKTSAVREGDEYVVNGQKIWTSQAHYSDWVFALVRTDPEAV
RKQAGISFLLIDLKSPGITVRPIISIDGRHSLNEVFFDNARVPVTNLVGEENKGWDYAKF
LLGHERAYIAGIGRNKERVACAKALLTKLASEGHPERELAGWRGRIALIEADLHALEVTQ
FRMHGGHADMKLSPMLKARGSEIFQAITDVICRMSGPAALRADGIGGPTLTKSYLYSRAV
SIFGGSTEVQKNILSATVLSLP
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggacctgttctactccgacgaacacaaggcgttccggcaggaagtgcgcgatttcatc
gccgccaacctgcctgacgacatgcgcgagcgcctgcgcgccggtggcttcgcctccaag
accgacaccgaacgctggcagcgcgcgctgaaccggcgcggctggggcgcgcccgcctgg
ccgacggccttcggcggcgctggctgggacgcggcgaaacagcagatttttgccgatgaa
tgcgccgccgcaccggcgcctcccccgcacatcttcaacatcacgatgctcggcccggtg
atcatccacttcggctccgatgcccagcgtgagtatttcctgccgaagctgttgaatgcc
gatatccaggtgtgccagggcttctccgagccgggctcgggctccgatctggcgtcgctg
aagacctctgccgtgcgcgaaggcgacgagtacgtcgtcaacggccagaagatctggacc
agccaggcgcattactccgactgggtgttcgcgctcgtacgcaccgatccggaagccgtg
cgcaagcaggccggcatttcgttcctgctgatcgacctgaaatcgccgggcatcaccgtg
cgcccgatcatcagcatcgacggccgccacagcctcaacgaagtcttcttcgacaacgcc
cgcgtgccggtgaccaacctcgtcggcgaggaaaacaagggctgggactacgcgaagttc
ctgctcggacacgagcgcgcgtacatcgccggtatcggccgcaacaaggaacgcgtggcc
tgcgcgaaggcgctgctgacgaagctggcaagcgaaggccatccggagcgtgagttggcc
ggctggcgcggccgcatcgcgctgatcgaggccgatctgcacgcgctcgaggtgacccag
ttccgcatgcacggcggccacgccgacatgaagctgtcgccgatgttgaaggcgcgcggc
agcgagatcttccaggccattaccgatgtgatctgccgcatgagcggccccgcggcgctg
cgcgccgatggcatcggcggccccacgctgaccaagtcatacctgtactcgcgcgccgta
tcaatcttcggcggcagtaccgaggtgcagaagaacatcctgtcggccaccgtgctgagc
ctgccatga

DBGET integrated database retrieval system