Cupriavidus pinatubonensis JMP134: Reut_C6348 Help Entry Reut_C6348        CDS       T00268                                  Name (GenBank) conserved hypothetical protein   KO K03746   DNA-binding protein H-NS Organism reu  Cupriavidus pinatubonensis JMP134 Brite KEGG Orthology (KO) [BR:reu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:reu03036]     Reut_C6348    03400 DNA repair and recombination proteins [BR:reu03400]     Reut_C6348 Chromosome and associated proteins [BR:reu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Reut_C6348 DNA repair and recombination proteins [BR:reu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Reut_C6348 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  AAZ65651 UniProt:  Q46MH9 LinkDB All DBs Position mega:523479..523730 Genome browser AA seq 83 aa AA seqDB search MTAKTERADAIRWIQTQMDDYGLTLEELDAAGCFAPPPPEPPPLPVACYRNAEGLTWDGQ GEMPSWLKRAVNAGQSVEFFRVG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacagcaaagactgagcgggcggacgcgatccgctggatccagacgcagatggatgac tacgggctcaccctcgaagagctcgacgcggcggggtgcttcgcgccgcccccacccgag ccacctccactgccggtggcctgctatcgcaacgccgaagggctgacctgggacgggcag ggcgagatgccctcgtggctcaagcgggccgtcaatgcgggccagagcgtagagtttttc cgggtcggatag

DBGET integrated database retrieval system