KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6466
Entry
Reut_D6466        CDS       T00268                                 
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6466
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Reut_D6466
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N DUF5706
Other DBs
NCBI-ProteinID: AAZ65764
UniProt: P0A396
LinkDB
Position
p1:complement(22778..23545)
AA seq 255 aa
MNKRVKDVVDAIVAAVQRVLDQKEVTEAEYRTAVHYLMQVAEQRETALLCDVFFNSTVAA
TKARISEGSTPAIEGPYYRDDAPLVDDRLKTYDTDDHKPLLIQGTVKAVDGSVVEDVTID
VWHSTPDGKYSGFHDDIPTDFYRGKLRVGTDGSFRVRTTMPVPYQIPDQGPTGALLETMG
GHSWRPAHVHFKVKAPGYETLTTQYYFEGGDWITDDCCNGVQSSLITPDIVEEGVRLMNI
NFVIEPARAQAGANP
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgaacaaaagagtcaaggatgttgtcgatgcgatcgtcgcggcggtacagcgggtgctc
gaccagaaggaggttactgaggcggaataccgaactgcggttcattacctcatgcaagta
gccgaacagcgtgaaaccgctcttctttgcgatgtttttttcaatagcaccgtggctgcg
acgaaggctcgtattagcgaaggttcaacgcctgctatcgagggaccctactatcgcgac
gacgcccctctggtcgatgaccggctcaagacttacgacacggacgaccacaagcctttg
cttatccagggaacggtcaaagcggtcgacgggagcgttgtcgaggacgtgacgattgat
gtctggcattcgacgcccgatgggaagtacagcggtttccatgacgacatcccgactgat
ttttatcgagggaagctcagggtgggcaccgatggcagcttccgcgtgcgcacaacgatg
ccggtgccgtatcagatcccggatcagggtcccacgggcgcattgctcgaaaccatgggt
ggtcactcgtggcgtcccgctcatgtacatttcaaggtgaaggcgccgggatatgaaacg
ttgaccacgcagtactacttcgaaggtggagattggatcacggacgactgttgcaacggc
gtccagtctagtctgattactcccgatattgtggaagagggtgtccgcctgatgaacatc
aacttcgttatcgagcccgcgcgtgcgcaggcgggggcaaacccgtga

DBGET integrated database retrieval system