KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6479
Entry
Reut_D6479        CDS       T00268                                 
Name
(GenBank) Taurine catabolism dioxygenase TauD/TfdA
  KO
K06912  alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase [EC:1.14.11.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6479
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-
     Reut_D6479
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AAZ65777
UniProt: P10088
LinkDB
Position
p1:36915..37778
AA seq 287 aa
MSVVANPLHPLFAAGVEDIDLREALGSTEVREIERLMDEKSVLVFRGQPLSQDQQIAFAR
NFGPLEGGFIKVNQRPSRFKYAELADISNVSLDGKVAQRDAREVVGNFANQLWHSDSSFQ
QPAARYSMLSAVVVPPSGGDTEFCDMRAAYDALPRDLQSELEGLRAEHYALNSRFLLGDT
DYSEAQRNAMPPVNWPLVRTHAGSGRKFLFIGAHASHVEGLPVAEGRMLLAELLEHATQR
EFVYRHRWNVGDLVMWDNRCVLHRGRRYDISARRELRRATTLDDAVV
NT seq 864 nt   +upstreamnt  +downstreamnt
gtgagcgtcgtcgcaaatccccttcatcctcttttcgccgcaggggtcgaagacatcgac
cttcgagaggccttgggttcgaccgaggtccgagagatcgaacggctaatggacgagaag
tcggtgctggtgttccgggggcagcccctgagtcaggatcagcagatcgccttcgcgcgc
aatttcgggccactcgaaggcggtttcatcaaggtcaatcaaagaccttcgagattcaag
tacgcggagttggcggacatctcgaacgtcagtctcgacggcaaggtcgcgcaacgcgat
gcgcgcgaggtggtcgggaacttcgcgaaccagctctggcacagcgacagctcctttcag
caacctgctgcccgctactcgatgctctccgcggtggtggttccgccgtcgggcggcgac
accgagttctgcgacatgcgtgcggcatacgacgcgctgcctcgggacctccaatccgag
ttggaagggctgcgtgccgagcactacgcactgaactcccgcttcctgctcggcgacacc
gactattcggaagcgcaacgcaatgccatgccgccggtcaactggccgctggttcgaacc
cacgccggctccgggcgcaagtttctcttcatcggcgcgcacgcgagccacgtcgaaggc
cttccggtggccgaaggccggatgctgcttgcggagcttctcgagcacgcgacacagcgg
gaattcgtgtaccggcatcgctggaacgtgggagatctggtgatgtgggacaaccgctgc
gttcttcaccgcggacgcaggtacgacatctcggccaggcgtgagctgcgccgggcgacc
accctggacgatgccgtcgtctag

DBGET integrated database retrieval system