Candidatus Reidiella endopervernicosa: HUE57_03400 Help Entry HUE57_03400       CDS       T06650                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism rev  Candidatus Reidiella endopervernicosa Brite KEGG Orthology (KO) [BR:rev00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rev03110]     HUE57_03400 (grxC) Chaperones and folding catalysts [BR:rev03110]  Protein folding catalysts   Protein disulfide isomerase    HUE57_03400 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 SH3BGR Glrx-like CLIC-like_N GST_N Thioredoxin_2 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  QKQ25448 UniProt:  A0A6N0HSS5 LinkDB All DBs Position 612560..612817 Genome browser AA seq 85 aa AA seqDB search MANVVIYSTGSCPYCVRARMLLEKKGISFEEFRIDEKPELRPEMERLSGRDSVPQIFIDE RRIGGFDDMYELDMDDELDPLLGLS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtggcgaacgttgtcatctacagtaccggttcatgtccatactgcgtgcgtgcgcgcatg ctgctcgagaaaaagggcatcagcttcgaagagtttagaatcgatgagaagcctgaattg cgacccgaaatggaacgtctcagtggccgtgacagcgtgcctcagatcttcatcgatgag cgccgtatcggtggttttgacgatatgtatgagctcgatatggatgacgaactcgatccg ttgctgggattgagctaa

DBGET integrated database retrieval system