Candidatus Reidiella endopervernicosa: HUE57_06005 Help Entry HUE57_06005       CDS       T06650                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism rev  Candidatus Reidiella endopervernicosa Brite KEGG Orthology (KO) [BR:rev00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rev03036]     HUE57_06005 Chromosome and associated proteins [BR:rev03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HUE57_06005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF7491 YabA Syntaxin bZIP_1 JIP_LZII Motif Other DBs NCBI-ProteinID:  QKQ28179 UniProt:  A0A6N0I0V3 LinkDB All DBs Position complement(1056814..1057014) Genome browser AA seq 66 aa AA seqDB search MDLQRLEQWLDDLIGTCERLNEENYVLRKENDLLSTERDELREKGDQARSRVETIVTRLK AMENSV NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggaccttcagcgcctggagcagtggctcgacgacctgatcggcacctgtgaacgactc aacgaagagaactatgtgctgcgcaaagagaacgatctgctcagcaccgagcgcgatgag ttgcgcgagaagggtgatcaggctcgttcgcgcgtagagaccatcgtcactcgacttaag gcgatggaaaactccgtatga

DBGET integrated database retrieval system