Candidatus Reidiella endopervernicosa: HUE57_12875 Help Entry HUE57_12875       CDS       T06650                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism rev  Candidatus Reidiella endopervernicosa Brite KEGG Orthology (KO) [BR:rev00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rev03036]     HUE57_12875 (ftsB) Chromosome and associated proteins [BR:rev03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HUE57_12875 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB bZIP_1 DegS Csm1_N DUF5320 SlyX Motif Other DBs NCBI-ProteinID:  QKQ27074 UniProt:  A0A6N0HXI1 LinkDB All DBs Position complement(2326264..2326536) Genome browser AA seq 90 aa AA seqDB search MRIVILILLLILLLLQYRLWVGDGSFAEVSRLQKSVAAQAEKNRLLRERNDALEAEVKDL KQGLSAIEERARSDLGMIKKDETYYQVVGD NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcgaattgtgatcctgatactgcttcttattctgctactactgcaataccgcctctgg gtgggagatggcagttttgctgaggtgagtcgactacagaagtcggtcgccgctcaagcg gagaagaatagattacttcgagagcgaaatgatgcacttgaggcagaagtgaaggatctc aaacaggggctttcagccattgaggagcgtgcccgtagtgatctgggcatgatcaaaaag gatgaaacctactaccaggtggtaggcgactga

DBGET integrated database retrieval system