Roseomonas fluvialis: Rmf_05080 Help Entry Rmf_05080         CDS       T08992                                  Symbol acpC Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rfl  Roseomonas fluvialis Pathway rfl01100   Metabolic pathways rfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rmf_05080 (acpC)    00074 Mycolic acid biosynthesis     Rmf_05080 (acpC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rmf_05080 (acpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  BDG70579 LinkDB All DBs Position complement(519120..519386) Genome browser AA seq 88 aa AA seqDB search MTTTLSLEAELARLIVEALHLEIAPEEIDPEAPLFGEGLGLDSIDALEIALAVSKRYGFQ LRSDDERNHRIFRSLRALAAHIETNRTG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt ttgacgacgaccctgtccttggaagcggagctggcccgtctgatcgtcgaggccctgcac ctcgagatcgcgccggaggagatcgacccggaggccccgctgttcggcgaggggcttggc ctcgattcgatcgatgcgctcgagatcgcgctggcggtgtccaagcgctacggcttccag ctgcggtcggacgacgaacgcaaccaccgcatcttccgctcgctccgcgcgctggccgcg catatcgagacgaaccggacgggctga

DBGET integrated database retrieval system