Roseomonas fluvialis: Rmf_35030
Help
Entry
Rmf_35030 CDS
T08992
Name
(GenBank) hypothetical protein
Organism
rfl
Roseomonas fluvialis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Flg_hook
Motif
Other DBs
NCBI-ProteinID:
BDG73574
UniProt:
A0ABN6P4K8
LinkDB
All DBs
Position
3629776..3631209
Genome browser
AA seq
477 aa
AA seq
DB search
MEIAPGAVAAQPGPATGAAPAALVEGGFAAALALAVAPTPPAVAHPAAPVQAVVPLTNAI
PSGASPPAGNLIGPPLETATAPDVTPPSQATPPVVTGGAVPPLPPAPQTPPAPEATLADD
PPATPLETPPTATAPPAPEPGLAPQDLAPAAEDTNAIPTATATTDAMPQAIAAMPVAPPQ
PRPDTAGAMSKDVASGAAAVPAVASARDVPKQGALEAPAPTAAADPAQDRPATAAPPPAA
TPARPAPAKAAPATVTTEEAPQAAPPSLPPVAPAAPTDQIVASPPAAAPSPVTDPRRTAE
PAAATQPAPGVEQGQATAPAEAPRTDTLAVEVPRAPPQAAPARQVLPAVIAVTIGGGGRI
AVTLEPVELGRVEISIERSNDIPQVVILAERPETLALLQRDQRELDRALNQAGLPAEGRA
LSFGLSSGDGGQGQPQRRREEGSGGNPTARGVHSRDPLSAAAAPPRRATLSLLDLAI
NT seq
1434 nt
NT seq
+upstream
nt +downstream
nt
atggaaatcgcgccaggcgcagtcgcagcccagccgggcccggccacgggcgccgcccct
gcggctctcgtcgagggaggcttcgccgcggcgcttgcgctggccgtcgcgccgacgccg
ccggcagtggcgcatcccgcggcgccggtgcaggccgtagtgccgctgaccaatgcgatc
ccgtccggcgcgtcgccgccggccggcaacctgattggcccgcccctcgagacggcgacc
gcacccgacgtcacgccgccgtctcaggcgacgccacccgtcgtgacaggcggcgcggtc
cccccgctaccaccggccccgcagacaccgcccgcgcccgaggccaccctggcggacgac
ccaccggcaacgccgctggagacaccgccgacggcgaccgcgccgcccgcgccggagccc
ggccttgcgccacaggacctcgcccccgcagcggaggataccaacgcaatacccacggcg
accgccaccactgacgcgatgccgcaggcgatcgcagcgatgccggtggcgcccccccag
ccaaggcctgacaccgccggcgcaatgtcgaaggacgttgcttccggtgccgcggcagtc
ccggccgtcgcatccgcgcgggatgtgccgaagcaaggcgcgctcgaagcgcccgcgccg
acggcggccgcagatccagcgcaggaccgccccgccacggccgcgccaccgccggcggcg
acacccgcgcggcccgcgcccgcgaaggccgccccggccacggtcacgaccgaggaggct
ccgcaggccgcgcccccgagcctgccaccggtcgcccccgccgcgccgaccgatcagatc
gtcgcgagcccgcccgccgcggcgccgtcacccgtgaccgacccccgccgcaccgccgag
ccggcggcggcgacccagcccgcgccaggtgtcgaacagggccaggccaccgcgccggcc
gaggcgccgcgcaccgacacgctggcggtggaagtgccgcgcgcgccgccgcaggctgca
ccggcgcgccaggtgcttcccgccgtgatcgccgtgacgatcggcggcggcggacgcatc
gccgtgacgctcgaaccggtcgaactcggccgcgtcgagatcagcatcgagcgtagcaac
gacatcccgcaggtggtgatcctggccgaacggcccgaaacgctcgcactgctgcagcgc
gaccagcgcgaactcgatcgtgcattgaaccaggccggactacccgcggaagggcgcgcc
ctgtccttcgggctgagcagcggcgatggcggccagggccaaccgcagcgccgccgcgag
gagggtagcggtggcaatcccacggcacgcggcgtgcacagtcgcgatccactgtccgcg
gccgcggcgccgccacgtcgcgcgacgctttcgctgctcgacctcgccatctga
DBGET
integrated database retrieval system