KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117014672
Entry
117014672         CDS       T07722                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq01521  EGFR tyrosine kinase inhibitor resistance
rfq01522  Endocrine resistance
rfq04010  MAPK signaling pathway
rfq04012  ErbB signaling pathway
rfq04014  Ras signaling pathway
rfq04015  Rap1 signaling pathway
rfq04062  Chemokine signaling pathway
rfq04068  FoxO signaling pathway
rfq04071  Sphingolipid signaling pathway
rfq04072  Phospholipase D signaling pathway
rfq04137  Mitophagy - animal
rfq04140  Autophagy - animal
rfq04150  mTOR signaling pathway
rfq04151  PI3K-Akt signaling pathway
rfq04210  Apoptosis
rfq04211  Longevity regulating pathway
rfq04213  Longevity regulating pathway - multiple species
rfq04218  Cellular senescence
rfq04360  Axon guidance
rfq04370  VEGF signaling pathway
rfq04371  Apelin signaling pathway
rfq04540  Gap junction
rfq04550  Signaling pathways regulating pluripotency of stem cells
rfq04625  C-type lectin receptor signaling pathway
rfq04650  Natural killer cell mediated cytotoxicity
rfq04660  T cell receptor signaling pathway
rfq04662  B cell receptor signaling pathway
rfq04664  Fc epsilon RI signaling pathway
rfq04714  Thermogenesis
rfq04720  Long-term potentiation
rfq04722  Neurotrophin signaling pathway
rfq04725  Cholinergic synapse
rfq04726  Serotonergic synapse
rfq04730  Long-term depression
rfq04810  Regulation of actin cytoskeleton
rfq04910  Insulin signaling pathway
rfq04912  GnRH signaling pathway
rfq04915  Estrogen signaling pathway
rfq04916  Melanogenesis
rfq04917  Prolactin signaling pathway
rfq04919  Thyroid hormone signaling pathway
rfq04921  Oxytocin signaling pathway
rfq04926  Relaxin signaling pathway
rfq04929  GnRH secretion
rfq04933  AGE-RAGE signaling pathway in diabetic complications
rfq04935  Growth hormone synthesis, secretion and action
rfq05010  Alzheimer disease
rfq05022  Pathways of neurodegeneration - multiple diseases
rfq05034  Alcoholism
rfq05160  Hepatitis C
rfq05161  Hepatitis B
rfq05163  Human cytomegalovirus infection
rfq05165  Human papillomavirus infection
rfq05166  Human T-cell leukemia virus 1 infection
rfq05167  Kaposi sarcoma-associated herpesvirus infection
rfq05170  Human immunodeficiency virus 1 infection
rfq05200  Pathways in cancer
rfq05203  Viral carcinogenesis
rfq05205  Proteoglycans in cancer
rfq05206  MicroRNAs in cancer
rfq05207  Chemical carcinogenesis - receptor activation
rfq05208  Chemical carcinogenesis - reactive oxygen species
rfq05210  Colorectal cancer
rfq05211  Renal cell carcinoma
rfq05213  Endometrial cancer
rfq05214  Glioma
rfq05215  Prostate cancer
rfq05216  Thyroid cancer
rfq05218  Melanoma
rfq05219  Bladder cancer
rfq05220  Chronic myeloid leukemia
rfq05221  Acute myeloid leukemia
rfq05223  Non-small cell lung cancer
rfq05224  Breast cancer
rfq05225  Hepatocellular carcinoma
rfq05226  Gastric cancer
rfq05230  Central carbon metabolism in cancer
rfq05231  Choline metabolism in cancer
rfq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rfq05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    117014672 (NRAS)
   04012 ErbB signaling pathway
    117014672 (NRAS)
   04014 Ras signaling pathway
    117014672 (NRAS)
   04015 Rap1 signaling pathway
    117014672 (NRAS)
   04370 VEGF signaling pathway
    117014672 (NRAS)
   04371 Apelin signaling pathway
    117014672 (NRAS)
   04068 FoxO signaling pathway
    117014672 (NRAS)
   04072 Phospholipase D signaling pathway
    117014672 (NRAS)
   04071 Sphingolipid signaling pathway
    117014672 (NRAS)
   04151 PI3K-Akt signaling pathway
    117014672 (NRAS)
   04150 mTOR signaling pathway
    117014672 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117014672 (NRAS)
   04137 Mitophagy - animal
    117014672 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    117014672 (NRAS)
   04218 Cellular senescence
    117014672 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    117014672 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    117014672 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117014672 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117014672 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    117014672 (NRAS)
   04660 T cell receptor signaling pathway
    117014672 (NRAS)
   04662 B cell receptor signaling pathway
    117014672 (NRAS)
   04664 Fc epsilon RI signaling pathway
    117014672 (NRAS)
   04062 Chemokine signaling pathway
    117014672 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    117014672 (NRAS)
   04929 GnRH secretion
    117014672 (NRAS)
   04912 GnRH signaling pathway
    117014672 (NRAS)
   04915 Estrogen signaling pathway
    117014672 (NRAS)
   04917 Prolactin signaling pathway
    117014672 (NRAS)
   04921 Oxytocin signaling pathway
    117014672 (NRAS)
   04926 Relaxin signaling pathway
    117014672 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    117014672 (NRAS)
   04919 Thyroid hormone signaling pathway
    117014672 (NRAS)
   04916 Melanogenesis
    117014672 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    117014672 (NRAS)
   04726 Serotonergic synapse
    117014672 (NRAS)
   04720 Long-term potentiation
    117014672 (NRAS)
   04730 Long-term depression
    117014672 (NRAS)
   04722 Neurotrophin signaling pathway
    117014672 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    117014672 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    117014672 (NRAS)
   04213 Longevity regulating pathway - multiple species
    117014672 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    117014672 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117014672 (NRAS)
   05206 MicroRNAs in cancer
    117014672 (NRAS)
   05205 Proteoglycans in cancer
    117014672 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    117014672 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    117014672 (NRAS)
   05203 Viral carcinogenesis
    117014672 (NRAS)
   05230 Central carbon metabolism in cancer
    117014672 (NRAS)
   05231 Choline metabolism in cancer
    117014672 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    117014672 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    117014672 (NRAS)
   05225 Hepatocellular carcinoma
    117014672 (NRAS)
   05226 Gastric cancer
    117014672 (NRAS)
   05214 Glioma
    117014672 (NRAS)
   05216 Thyroid cancer
    117014672 (NRAS)
   05221 Acute myeloid leukemia
    117014672 (NRAS)
   05220 Chronic myeloid leukemia
    117014672 (NRAS)
   05218 Melanoma
    117014672 (NRAS)
   05211 Renal cell carcinoma
    117014672 (NRAS)
   05219 Bladder cancer
    117014672 (NRAS)
   05215 Prostate cancer
    117014672 (NRAS)
   05213 Endometrial cancer
    117014672 (NRAS)
   05224 Breast cancer
    117014672 (NRAS)
   05223 Non-small cell lung cancer
    117014672 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    117014672 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    117014672 (NRAS)
   05161 Hepatitis B
    117014672 (NRAS)
   05160 Hepatitis C
    117014672 (NRAS)
   05163 Human cytomegalovirus infection
    117014672 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117014672 (NRAS)
   05165 Human papillomavirus infection
    117014672 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117014672 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    117014672 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    117014672 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117014672 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    117014672 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    117014672 (NRAS)
   01522 Endocrine resistance
    117014672 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rfq04131]
    117014672 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfq04147]
    117014672 (NRAS)
   04031 GTP-binding proteins [BR:rfq04031]
    117014672 (NRAS)
Membrane trafficking [BR:rfq04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    117014672 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    117014672 (NRAS)
Exosome [BR:rfq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117014672 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   117014672 (NRAS)
  Exosomal proteins of breast cancer cells
   117014672 (NRAS)
  Exosomal proteins of colorectal cancer cells
   117014672 (NRAS)
GTP-binding proteins [BR:rfq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    117014672 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 117014672
NCBI-ProteinID: XP_032948669
Ensembl: ENSRFEG00010015972
UniProt: A0A671FJG5
LinkDB
Position
22:complement(45392289..45399228)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgacc
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggactcttac
cgaaaacaggtggttatagatggtgaaacctgcctcttggacatactggatacagccggt
caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggtttcctctgt
gtattcgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaggactcagatgacgtacctatggtgctagtagggaacaagtgtgatttg
ccaacaaggacggtggacacaaaacaagcccacgaactggccaagagttacgggattcca
tttatcgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggcactcaaggt
tgcatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system