KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117016447
Entry
117016447         CDS       T07722                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq04010  MAPK signaling pathway
rfq04014  Ras signaling pathway
rfq04015  Rap1 signaling pathway
rfq04024  cAMP signaling pathway
rfq04062  Chemokine signaling pathway
rfq04071  Sphingolipid signaling pathway
rfq04145  Phagocytosis
rfq04148  Efferocytosis
rfq04151  PI3K-Akt signaling pathway
rfq04310  Wnt signaling pathway
rfq04360  Axon guidance
rfq04370  VEGF signaling pathway
rfq04380  Osteoclast differentiation
rfq04510  Focal adhesion
rfq04517  IgSF CAM signaling
rfq04518  Integrin signaling
rfq04519  Cadherin signaling
rfq04520  Adherens junction
rfq04530  Tight junction
rfq04613  Neutrophil extracellular trap formation
rfq04620  Toll-like receptor signaling pathway
rfq04650  Natural killer cell mediated cytotoxicity
rfq04662  B cell receptor signaling pathway
rfq04664  Fc epsilon RI signaling pathway
rfq04666  Fc gamma R-mediated phagosome formation
rfq04670  Leukocyte transendothelial migration
rfq04722  Neurotrophin signaling pathway
rfq04810  Regulation of actin cytoskeleton
rfq04932  Non-alcoholic fatty liver disease
rfq04933  AGE-RAGE signaling pathway in diabetic complications
rfq04972  Pancreatic secretion
rfq05014  Amyotrophic lateral sclerosis
rfq05020  Prion disease
rfq05022  Pathways of neurodegeneration - multiple diseases
rfq05100  Bacterial invasion of epithelial cells
rfq05132  Salmonella infection
rfq05135  Yersinia infection
rfq05163  Human cytomegalovirus infection
rfq05167  Kaposi sarcoma-associated herpesvirus infection
rfq05169  Epstein-Barr virus infection
rfq05170  Human immunodeficiency virus 1 infection
rfq05200  Pathways in cancer
rfq05203  Viral carcinogenesis
rfq05205  Proteoglycans in cancer
rfq05208  Chemical carcinogenesis - reactive oxygen species
rfq05210  Colorectal cancer
rfq05211  Renal cell carcinoma
rfq05212  Pancreatic cancer
rfq05231  Choline metabolism in cancer
rfq05415  Diabetic cardiomyopathy
rfq05416  Viral myocarditis
rfq05417  Lipid and atherosclerosis
rfq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    117016447 (RAC1)
   04014 Ras signaling pathway
    117016447 (RAC1)
   04015 Rap1 signaling pathway
    117016447 (RAC1)
   04310 Wnt signaling pathway
    117016447 (RAC1)
   04370 VEGF signaling pathway
    117016447 (RAC1)
   04071 Sphingolipid signaling pathway
    117016447 (RAC1)
   04024 cAMP signaling pathway
    117016447 (RAC1)
   04151 PI3K-Akt signaling pathway
    117016447 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    117016447 (RAC1)
   04518 Integrin signaling
    117016447 (RAC1)
   04519 Cadherin signaling
    117016447 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagocytosis
    117016447 (RAC1)
   04148 Efferocytosis
    117016447 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    117016447 (RAC1)
   04520 Adherens junction
    117016447 (RAC1)
   04530 Tight junction
    117016447 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117016447 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    117016447 (RAC1)
   04620 Toll-like receptor signaling pathway
    117016447 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    117016447 (RAC1)
   04662 B cell receptor signaling pathway
    117016447 (RAC1)
   04664 Fc epsilon RI signaling pathway
    117016447 (RAC1)
   04666 Fc gamma R-mediated phagosome formation
    117016447 (RAC1)
   04670 Leukocyte transendothelial migration
    117016447 (RAC1)
   04062 Chemokine signaling pathway
    117016447 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    117016447 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    117016447 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    117016447 (RAC1)
   04380 Osteoclast differentiation
    117016447 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117016447 (RAC1)
   05205 Proteoglycans in cancer
    117016447 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    117016447 (RAC1)
   05203 Viral carcinogenesis
    117016447 (RAC1)
   05231 Choline metabolism in cancer
    117016447 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    117016447 (RAC1)
   05212 Pancreatic cancer
    117016447 (RAC1)
   05211 Renal cell carcinoma
    117016447 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117016447 (RAC1)
   05163 Human cytomegalovirus infection
    117016447 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117016447 (RAC1)
   05169 Epstein-Barr virus infection
    117016447 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    117016447 (RAC1)
   05135 Yersinia infection
    117016447 (RAC1)
   05100 Bacterial invasion of epithelial cells
    117016447 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117016447 (RAC1)
   05020 Prion disease
    117016447 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    117016447 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117016447 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    117016447 (RAC1)
   05415 Diabetic cardiomyopathy
    117016447 (RAC1)
   05416 Viral myocarditis
    117016447 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    117016447 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    117016447 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rfq04131]
    117016447 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rfq04147]
    117016447 (RAC1)
   04031 GTP-binding proteins [BR:rfq04031]
    117016447 (RAC1)
Membrane trafficking [BR:rfq04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    117016447 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    117016447 (RAC1)
  Macropinocytosis
   Ras GTPases
    117016447 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    117016447 (RAC1)
Exosome [BR:rfq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117016447 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   117016447 (RAC1)
  Exosomal proteins of colorectal cancer cells
   117016447 (RAC1)
  Exosomal proteins of bladder cancer cells
   117016447 (RAC1)
GTP-binding proteins [BR:rfq04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    117016447 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 117016447
NCBI-ProteinID: XP_032951582
Ensembl: ENSRFEG00010009950
LinkDB
Position
24:41104992..41125510
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctcctg
atcagttacacaaccaatgcatttcctggagagtatatccccactgtttttgacaactat
tctgccaatgttatggtcgatgggaaacccgtgaatctgggcttgtgggatactgcggga
caagaggactacgaccgactacggcccctctcctatccgcagacagatgtattcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtatcctgag
gtgcgacaccattgtcccaacacgcccatcatcctggtggggactaagcttgatcttagg
gacgataaagacacgattgagaaactgaaggagaagaagctgacgcccatcacctaccca
cagggcttggccatggctaaggagatcggtgctgtaaagtacctggagtgctcggctctc
acacagcgcggcctcaagacagtgtttgatgaagccattcgagccgttctctgcccacct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system