Rhinolophus ferrumequinum (greater horseshoe bat): 117024956
Help
Entry
117024956 CDS
T07722
Name
(RefSeq) ATP synthase F(0) complex subunit C3, mitochondrial-like
KO
K02128
F-type H+-transporting ATPase subunit c
Organism
rfq
Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq00190
Oxidative phosphorylation
rfq01100
Metabolic pathways
rfq04714
Thermogenesis
rfq05010
Alzheimer disease
rfq05012
Parkinson disease
rfq05014
Amyotrophic lateral sclerosis
rfq05016
Huntington disease
rfq05020
Prion disease
rfq05022
Pathways of neurodegeneration - multiple diseases
rfq05208
Chemical carcinogenesis - reactive oxygen species
rfq05415
Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:
rfq00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
117024956
09150 Organismal Systems
09159 Environmental adaptation
04714 Thermogenesis
117024956
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
117024956
09164 Neurodegenerative disease
05010 Alzheimer disease
117024956
05012 Parkinson disease
117024956
05014 Amyotrophic lateral sclerosis
117024956
05016 Huntington disease
117024956
05020 Prion disease
117024956
05022 Pathways of neurodegeneration - multiple diseases
117024956
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
117024956
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-GeneID:
117024956
NCBI-ProteinID:
XP_032966593
Ensembl:
ENSRFEG00010004606
UniProt:
A0A671E071
LinkDB
All DBs
Position
7:20773165..20773859
Genome browser
AA seq
107 aa
AA seq
DB search
MFSCAKLACTPALIGAGSRVTYRPISASVLSRPEARTGEGSTVFNGAQNGVSQLIQREFQ
TSAISRDIDTAAKFIVAGAATVGVAGSGAGIGTVFGSLIVIGYARNP
NT seq
324 nt
NT seq
+upstream
nt +downstream
nt
atgttctcctgcgccaagcttgcctgcacccccgctctgatcggagctggatccagagtt
acatacagaccaatttctgcatcagtgttatcccgaccagaggctaggactggagagggc
tctacggtatttaatggggcccagaatggtgtgtctcagctaatccaaagggagtttcag
accagtgcaatcagcagagacattgatactgctgccaaatttattgttgcaggtgctgca
acagtaggagtggctggttctggtgctggtattggaacagtctttggtagccttatcgtt
attggctacgccagaaacccttag
DBGET
integrated database retrieval system