KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117036135
Entry
117036135         CDS       T07722                                 
Name
(RefSeq) S-phase kinase-associated protein 1-like
  KO
K03094  S-phase kinase-associated protein 1
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq03083  Polycomb repressive complex
rfq04110  Cell cycle
rfq04114  Oocyte meiosis
rfq04120  Ubiquitin mediated proteolysis
rfq04141  Protein processing in endoplasmic reticulum
rfq04310  Wnt signaling pathway
rfq04350  TGF-beta signaling pathway
rfq04710  Circadian rhythm
rfq05132  Salmonella infection
rfq05170  Human immunodeficiency virus 1 infection
rfq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    117036135
   04120 Ubiquitin mediated proteolysis
    117036135
  09126 Chromosome
   03083 Polycomb repressive complex
    117036135
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    117036135
   04350 TGF-beta signaling pathway
    117036135
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    117036135
   04114 Oocyte meiosis
    117036135
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    117036135
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117036135
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117036135
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    117036135
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rfq04131]
    117036135
   04121 Ubiquitin system [BR:rfq04121]
    117036135
   03036 Chromosome and associated proteins [BR:rfq03036]
    117036135
Membrane trafficking [BR:rfq04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    117036135
Ubiquitin system [BR:rfq04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     117036135
   Cul7 complex
     117036135
Chromosome and associated proteins [BR:rfq03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     117036135
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     117036135
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 117036135
NCBI-ProteinID: XP_032986682
Ensembl: ENSRFEG00010006474
UniProt: A0A671EG88
LinkDB
Position
16:43700499..43701330
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVIC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcgattaagttgcagagttctgatggagagatatttgaagttgatgttgaaatt
gccaaacaatctgtgactatcaagaccatgttggaagatttgggaatggatgatgaaggc
gatgatgacccagttcctctaccgaatgttaatgcagcgatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctccacctcctgaggatgatgagaacaaagaaaag
cgaacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgagcttattctggctgcaaactacttagacatcaagggtttgcttgatgttatatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagattcgcaagaccttcaat
ataaaaaatgacttcactgaagaagaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system