KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117037364
Entry
117037364         CDS       T07722                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq04927  Cortisol synthesis and secretion
rfq04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    117037364 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    117037364 (MRAP)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 117037364
NCBI-ProteinID: XP_032989199
Ensembl: ENSRFEG00010000197
LinkDB
Position
2:98540795..98557010
AA seq 214 aa
MWAGLEPGDPQTHLDDFTEIIRPAYSDALPPSATDMANRTNASSLYYSYEYYMDYLDLIP
VDEKKLTANKHSIVIAFWLSLAAFVVLLFLILLYMSCSGSLHGRNNGHHHPTCSWSHGLH
LPLCIRRFLRRHRAPGATPQASPSSVKEPGSTARGPHHPLQEGPCTSPPTRPTPRPSLLS
PGNWPSTGTHMPSADVSNKPREPPLGDRTSRMQN
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtgggcaggccttgagcctggagacccacagacacacttagatgattttacggaaatc
attcggccagcctactccgatgcactgcctcccagcgccacagacatggccaacaggacc
aacgcctcctccctgtactacagctacgagtactacatggattacctggacctcattccc
gtggatgagaagaagctgacagccaacaaacattcgattgtcattgccttctggctgagc
ctggctgcttttgtggtgcttctcttcctcatcctgctctacatgtcctgctcaggctcc
ctgcacgggaggaacaacggccaccatcaccccacatgctcctggagtcatggcctccat
ctccccctctgcatccggaggttcctgcggcgtcacagggcccctggggccaccccgcag
gcttcaccaagctcagtcaaggagccaggcagcacagcacgtggcccccatcatccgctg
caggagggcccctgcacttcaccccccacccgtcccacccccaggcccagcctgctctcc
ccggggaactggccctcgacggggacccacatgccatcagctgatgtcagcaacaagccc
agggagcctccccttggagacagaacctctcgaatgcagaactga

DBGET integrated database retrieval system