Rhodoferax ferrireducens: Rfer_0384 Help Entry Rfer_0384         CDS       T00334                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism rfr  Rhodoferax ferrireducens Pathway rfr01100   Metabolic pathways rfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rfer_0384    00074 Mycolic acid biosynthesis     Rfer_0384   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rfer_0384 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABD68138 UniProt:  Q222B5 LinkDB All DBs Position complement(392468..392719) Genome browser AA seq 83 aa AA seqDB search MSTDRAALMATVLTLLRAIAPEVEPGTLTPERPLRQQVDLDSMDWLNFLLSLHERFGVSI PESDYAGLVCLNDVVNYLQARLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgaccgagccgcactgatggcaaccgtgctgacactgctgcgcgccatcgcg ccggaagtggagcccgggacactgacgcccgagcgccccttgcgccagcaggtggatctg gattcgatggactggctcaactttctgctgagcctgcatgaacgcttcggggtgagcatc ccggaatcagactacgcggggctggtttgtctcaatgacgtggtgaactacctgcaagcc agactgaaatga

DBGET integrated database retrieval system