Rhodoferax ferrireducens: Rfer_0698 Help Entry Rfer_0698         CDS       T00334                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism rfr  Rhodoferax ferrireducens Pathway rfr01100   Metabolic pathways rfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rfer_0698    00074 Mycolic acid biosynthesis     Rfer_0698   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rfer_0698 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABD68449 UniProt:  Q220V4 LinkDB All DBs Position complement(734666..734917) Genome browser AA seq 83 aa AA seqDB search MNISQEVLRVVDEVLSLNGRSATFTRDTPLLGAIPELDSMAVVTLITTLEEQFGLVVDDD DIDGSTFATVGSLTDFVSSKLAT NT seq 252 nt NT seq  +upstreamnt  +downstreamnt ttgaacatatcacaagaagtacttcgtgttgttgacgaagttctaagtctgaatggacgc tccgccaccttcacacgcgacacccccttgctgggcgccatccccgagctggattccatg gcggtcgtgacgctcatcaccacccttgaagaacagtttggcctggtggtggacgatgac gacatcgatggctcaacctttgccacggtgggctcgctgactgactttgtcagcagcaaa ctggcgacttaa

DBGET integrated database retrieval system