Rhodoferax ferrireducens: Rfer_3978 Help Entry Rfer_3978         CDS       T00334                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rfr  Rhodoferax ferrireducens Pathway rfr01100   Metabolic pathways rfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rfer_3978    00074 Mycolic acid biosynthesis     Rfer_3978   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rfer_3978 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Phage_sheath_1C Motif Other DBs NCBI-ProteinID:  ABD71676 UniProt:  Q21RC7 LinkDB All DBs Position complement(4443947..4444219) Genome browser AA seq 90 aa AA seqDB search MNEHDIAFRSELKAYILSAVDKTEPADGLRDDEPWFGSESRLDLDSLDALQISMAIQKKY RVRMPDSKDTRRAMVSLLALAEYLRTHQPT NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacgaacacgacattgcattccgctccgaattaaaagcgtacatcctctctgccgtg gataagacagaacctgccgatggactgcgcgacgacgagccgtggttcgggtcagagtcc cggttggatctcgattcactcgatgccctgcagatttccatggcgattcaaaaaaagtac cgcgtgcgcatgcccgacagcaaagacacgcgtcgcgcgatggtctcgttgttggccttg gctgagtatctgcgcacgcatcaaccgacatga

DBGET integrated database retrieval system