Rhodoferax ferrireducens: Rfer_3980 Help Entry Rfer_3980         CDS       T00334                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rfr  Rhodoferax ferrireducens Pathway rfr01100   Metabolic pathways rfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rfr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rfer_3980    00074 Mycolic acid biosynthesis     Rfer_3980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rfer_3980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABD71678 UniProt:  Q21RC5 LinkDB All DBs Position 4445194..4445481 Genome browser AA seq 95 aa AA seqDB search MTTLSSPAEANAKLEREVAQLMVSALNLEVAPESIQADSELYGDGLGLDSIDILEIALVV SKQYGIQMKTEGEDNFAIFKSLRSLSAYIAEKRTK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgactaccctatccagtcccgctgaggccaacgcaaaactcgaacgcgaagtggctcaa ctcatggtctcggcgctgaatcttgaggtcgcaccagagagcatccaagccgactccgag ttgtacggcgatggcttgggcctggattccattgacattctggaaattgcgctggtggtg tccaaacaatatggcattcagatgaagaccgagggtgaagacaacttcgccatcttcaag tcgctgcgcagcctgagtgcctatatcgcggaaaagcgcaccaagtga

DBGET integrated database retrieval system