Rathayibacter festucae: C1I64_04245 Help Entry C1I64_04245       CDS       T06173                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rfs  Rathayibacter festucae Pathway rfs01100   Metabolic pathways rfs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rfs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1I64_04245    00074 Mycolic acid biosynthesis     C1I64_04245   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1I64_04245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AZZ51330 UniProt:  A0A3Q9UR00 LinkDB All DBs Position complement(909318..909566) Genome browser AA seq 82 aa AA seqDB search MALSNEEVLAGLAELVNDETGIATDSVEMEKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DDEVKNLKTVGDAVTFIVKASA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaacgaagaagtcctcgccggcctggccgaactggtcaacgacgagacc ggcatcgcgaccgattccgtcgagatggagaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgaccatcgtggtcaacgccgaggagaagttcgacgtgaagatcccg gacgacgaggtcaagaacctcaagacggtcggcgacgcggtcaccttcatcgtcaaggcc tccgcgtaa

DBGET integrated database retrieval system