KEGG   Pseudorhizobium flavum: RFYW14_00826
Entry
RFYW14_00826      CDS       T07144                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rfv  Pseudorhizobium flavum
Pathway
rfv00260  Glycine, serine and threonine metabolism
rfv00750  Vitamin B6 metabolism
rfv01100  Metabolic pathways
rfv01110  Biosynthesis of secondary metabolites
rfv01120  Microbial metabolism in diverse environments
rfv01230  Biosynthesis of amino acids
Module
rfv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RFYW14_00826
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RFYW14_00826
Enzymes [BR:rfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RFYW14_00826
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: CAD6601082
LinkDB
Position
1:complement(842525..843922)
AA seq 465 aa
MEYISTRGEAPVLGFRDALLAGLARDGGLYVPREWPVLTKREIRALRGKSYQEVAFEILR
HFTGEEIPADKLRSMIDEAYATFRHPAIAPLVQTGPNDFVLELFHGTTLAFKDVAMQLLA
RLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPKGKVSPVQQRQMTTS
PDANVHALAIEGNFDECQTLVKEMFNDAGFRDRVRLSGVNSINWARIMAQVVYYFTAALS
LGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIERLVIATNDNDILARTLKTGRYEMRAV
KATTSPSMDIQISSNFERLLFEAHGRDPVAVRAAMAGLKQSGAFEIETNALKAIRREFRA
ARATEKQVAATIRETLADTGYLLDPHTATAVFVARKHAKPSSPMVTLATAHPAKFPAAVK
SACGIDPALPSWLGDLMNREERFDILPAEIRAVEKFIGDHARAGK
NT seq 1398 nt   +upstreamnt  +downstreamnt
gtggaatacatttctacccgcggagaagcacctgttctcggcttccgtgatgcgcttctc
gcaggcctcgcgcgcgatggcggcctctatgtgccgcgcgaatggccggtcctgacgaag
cgggagatccgggccctgcgcggcaagtcctaccaggaggtggcgttcgagatcctgcgc
cacttcacgggcgaggagatccctgccgacaagctgcggtccatgatcgacgaggcctat
gccaccttccggcatcccgccattgcaccactcgtgcagacggggccgaatgatttcgtt
cttgagcttttccatggcacgaccttggctttcaaggacgtcgccatgcagttgcttgcg
cggctgatggatcatgtccttgccgagcgcggcgagcgggcgacgatagtcggtgcgaca
tccggtgatacgggcggcgcggcaatcgacgcattcgcggggcgtgaccggaccgatatc
ttcattctcttccccaagggaaaggtgtcgccggtccagcaacgccagatgaccacatcc
ccggatgccaacgttcatgcactggcgatcgaaggcaatttcgacgaatgccagacgctg
gtgaaggagatgttcaacgatgcgggcttccgcgaccgcgtcaggctttcgggcgtgaac
tccatcaactgggcccgcatcatggcccaggttgtctactacttcacggcagcgctatcg
ctcggcggtcctgaccggaagatctcctttacagttccaaccggaaacttcggcgacatc
tttgccggttacgtcgccaagcgcatgggcctgcccattgagcggctggtgatcgccacg
aacgacaacgacatcctggcccgcaccctgaagaccggtcgttacgagatgcgggcggtc
aaggcgaccacctcgccttcgatggacatccagatctcgtcgaacttcgagcgacttctg
tttgaggcccatgggcgcgacccagtggccgttcgtgccgcgatggctggcctcaagcag
tccggcgccttcgaaatagagacgaatgccctgaaggcgatccgacgtgagttccgcgct
gcacgagcgactgaaaagcaggtagctgcgacaatccgcgaaacgctagccgataccggg
tacctgctcgacccgcacacggcgaccgcagtcttcgtggccaggaagcacgcaaaacca
agcagccccatggtaacattggccacggcccaccccgccaagttcccggccgcggtaaaa
tccgcttgcggaattgacccggcgctcccatcatggctcggcgatctaatgaacagggag
gagcgcttcgacatcctgcctgcggagatcagggccgtcgagaagttcatcggcgaccac
gcccgtgcaggtaagtga

DBGET integrated database retrieval system