KEGG   Pseudorhizobium flavum: RFYW14_01396
Entry
RFYW14_01396      CDS       T07144                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
rfv  Pseudorhizobium flavum
Pathway
rfv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rfv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RFYW14_01396
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rfv02000]
    RFYW14_01396
Enzymes [BR:rfv01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     RFYW14_01396
Transporters [BR:rfv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    RFYW14_01396
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_22 SMC_N ATP-synt_ab RsgA_GTPase AAA_16 nSTAND1 MMR_HSR1 DUF4350 DO-GTPase2 AAA_30 AAA_23 NB-ARC DUF87
Other DBs
NCBI-ProteinID: CAD6603516
LinkDB
Position
1:complement(1384831..1385688)
AA seq 285 aa
MRLTNLTRIFGTRTAVDAVTLDIPQGQMVGIIGRSGAGKSTLLRMMNRLTDASSGTIHFG
DLEISALRGAELRRWQRDCAMIFQQFNLVPRLDVLTNVLLGRLNHRSTAMSVLNLFTREE
RIMAIAALERLGIEQTALQRAGTLSGGQQQRVAIARALMQAPRLVLADEPIASLDPLNAK
IVMDALRDINEREGITVITNLHTLDTARAYCERIIGMAGGRVVFDGAPHELTADAVQEIY
GSDRHGAGIDETMTSTSINIPAAAAAAAAAARPSVGIGALAAASA
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcgactgacgaaccttactcggatatttgggacgcgcacagccgttgacgccgtcacc
ctggacatcccgcagggccagatggtcgggatcatcggccgctcgggtgccggcaagtcg
accctgctgcggatgatgaacaggctcaccgacgcttcatccggtacaatccacttcgga
gacctggaaatctctgccctccggggagccgagcttcgccgttggcagcgcgactgcgcg
atgatcttccaacagttcaatctcgtgccgcggctcgacgtcctgaccaatgtcctgctc
ggacggctcaaccaccgctccacggccatgagtgtgctcaacctcttcacccgcgaagag
cgcatcatggcaatcgccgccctggaacggcttgggatcgaacagactgcgctgcagcgg
gccggcacactgtccggcggccagcaacaacgcgtcgcgatcgcccgcgcgctgatgcaa
gccccacggctggtcctcgccgacgaacccattgcctcgctcgacccgctcaacgcgaag
atcgtcatggacgcgctgcgcgacatcaacgagcgcgagggcatcaccgtcatcaccaac
ctccacacgctcgatacggcccgcgcctactgcgagcgcattatcggaatggccggcgga
cgggtggtcttcgacggcgctccgcacgaactgacggcggacgctgtccaggaaatctac
ggttccgaccggcatggtgccggcatcgacgagacgatgacgtccaccagcatcaacatt
cctgcggccgccgcagccgccgcagccgccgcccgaccatccgtaggcatcggtgccctg
gctgccgccagcgcctga

DBGET integrated database retrieval system