Pseudorhizobium flavum: RFYW14_01396
Help
Entry
RFYW14_01396 CDS
T07144
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
rfv
Pseudorhizobium flavum
Pathway
rfv02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
rfv00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
RFYW14_01396
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rfv02000
]
RFYW14_01396
Enzymes [BR:
rfv01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
RFYW14_01396
Transporters [BR:
rfv02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
RFYW14_01396
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
AAA_22
SMC_N
ATP-synt_ab
RsgA_GTPase
AAA_16
nSTAND1
MMR_HSR1
DUF4350
DO-GTPase2
AAA_30
AAA_23
NB-ARC
DUF87
Motif
Other DBs
NCBI-ProteinID:
CAD6603516
LinkDB
All DBs
Position
1:complement(1384831..1385688)
Genome browser
AA seq
285 aa
AA seq
DB search
MRLTNLTRIFGTRTAVDAVTLDIPQGQMVGIIGRSGAGKSTLLRMMNRLTDASSGTIHFG
DLEISALRGAELRRWQRDCAMIFQQFNLVPRLDVLTNVLLGRLNHRSTAMSVLNLFTREE
RIMAIAALERLGIEQTALQRAGTLSGGQQQRVAIARALMQAPRLVLADEPIASLDPLNAK
IVMDALRDINEREGITVITNLHTLDTARAYCERIIGMAGGRVVFDGAPHELTADAVQEIY
GSDRHGAGIDETMTSTSINIPAAAAAAAAAARPSVGIGALAAASA
NT seq
858 nt
NT seq
+upstream
nt +downstream
nt
atgcgactgacgaaccttactcggatatttgggacgcgcacagccgttgacgccgtcacc
ctggacatcccgcagggccagatggtcgggatcatcggccgctcgggtgccggcaagtcg
accctgctgcggatgatgaacaggctcaccgacgcttcatccggtacaatccacttcgga
gacctggaaatctctgccctccggggagccgagcttcgccgttggcagcgcgactgcgcg
atgatcttccaacagttcaatctcgtgccgcggctcgacgtcctgaccaatgtcctgctc
ggacggctcaaccaccgctccacggccatgagtgtgctcaacctcttcacccgcgaagag
cgcatcatggcaatcgccgccctggaacggcttgggatcgaacagactgcgctgcagcgg
gccggcacactgtccggcggccagcaacaacgcgtcgcgatcgcccgcgcgctgatgcaa
gccccacggctggtcctcgccgacgaacccattgcctcgctcgacccgctcaacgcgaag
atcgtcatggacgcgctgcgcgacatcaacgagcgcgagggcatcaccgtcatcaccaac
ctccacacgctcgatacggcccgcgcctactgcgagcgcattatcggaatggccggcgga
cgggtggtcttcgacggcgctccgcacgaactgacggcggacgctgtccaggaaatctac
ggttccgaccggcatggtgccggcatcgacgagacgatgacgtccaccagcatcaacatt
cctgcggccgccgcagccgccgcagccgccgcccgaccatccgtaggcatcggtgccctg
gctgccgccagcgcctga
DBGET
integrated database retrieval system