Rhizobium gallicum bv. gallicum: RGR602_CH00033 Help Entry RGR602_CH00033    CDS       T03539                                  Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism rga  Rhizobium gallicum bv. gallicum Pathway rga02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:rga00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     RGR602_CH00033  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:rga02000]     RGR602_CH00033 Transporters [BR:rga02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     RGR602_CH00033 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AJD39416 UniProt:  A0A0B4WWL2 LinkDB All DBs Position complement(36992..37267) Genome browser AA seq 91 aa AA seqDB search MTSFSRELLIVNKRGLHARASAKFVQMVETFDAAVTVSKDGMTVGGTSIMGLMMLAASPG TTVLVSASGNQAAEALNALDQLVQDKFGEEM NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacctcgttttcccgggaactgctcatcgtaaacaagcgcggccttcacgcgcgcgcc tccgccaaattcgtccaaatggtcgaaacattcgacgctgccgttactgtctccaaggac ggaatgacagtcggcggcacctcgatcatgggcttgatgatgcttgccgcgagtccgggc acgacagttctcgtttctgcgagcggcaatcaggcggccgaagcgctgaacgcattggat caattggttcaggacaagttcggcgaagaaatgtag

DBGET integrated database retrieval system