Rhizobium gallicum bv. gallicum: RGR602_CH03868
Help
Entry
RGR602_CH03868 CDS
T03539
Name
(GenBank) signal recognition particle-docking FtsY protein
KO
K03110
fused signal recognition particle receptor
Organism
rga
Rhizobium gallicum bv. gallicum
Pathway
rga02024
Quorum sensing
rga03060
Protein export
rga03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
rga00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
RGR602_CH03868
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
RGR602_CH03868
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
RGR602_CH03868
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
rga02044
]
RGR602_CH03868
Secretion system [BR:
rga02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
RGR602_CH03868
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SRP54
SRP54_N
AAA_30
AAA_17
AAA_22
AAA_16
AAA
Zeta_toxin
MeaB
AAA_24
AAA_19
AAA_18
SLFN-g3_helicase
NTPase_1
HerA_C
APS_kinase
nSTAND3
MobB
DUF1611
AAA_28
CbiA
AAA_7
Helicase_RecD
Thymidylate_kin
AAA_33
PIF1
YqeC
ResIII
AAA_23
BBP2_2
T2SSE
AAA_5
Viral_helicase1
AAA_31
ABC_tran
NACHT
Motif
Other DBs
NCBI-ProteinID:
AJD43166
UniProt:
A0A0B4X7K4
LinkDB
All DBs
Position
complement(3921293..3922876)
Genome browser
AA seq
527 aa
AA seq
DB search
MALSFIKKVFTFGKEKPAEEQAPEAPETKVLEAELEPHSREEHLPLASDPVLSEELDTPG
GPAADAVEPSEDAEESAILPSAYQIGDLGVIPLSLLEAEAEAEPETSAQDAPLAETPPSV
PSGHFPHEGKDQLADEAPLSDASRDEVTDIRPEISGTAEGGQSAPAQPTSLLVGEMPGKV
EGDAPRPEADGEHASRTEPVLPKGFATTPKITEPEPIVPAPKLSWFQRLRAGLARTSSQL
TGQISALFTKRKLDDDTLQDLEDLLIQADLGVETAMRVTDTLASERYGKDVTGEDVSRIM
ASEIAKVLKPVARPLQLDLTHKPHVILVVGVNGTGKTTTIGKLASKLSGAGLKVMVAAGD
TFRAAAIEQLKIWADRTKSEFIGTKLGADAAGLAYDAFEQAKAKKCDVLIIDTAGRLQNK
AELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALNQVEIFRNVAGVNGLIMTKLDG
TARGGILVAISAKHKLPVYFIGVGEGVDDLEPFEAEDFAQAIAGLGQ
NT seq
1584 nt
NT seq
+upstream
nt +downstream
nt
atggcgctcagtttcatcaaaaaggtcttcaccttcggcaaggaaaagccggcggaagag
caggcgccagaggctccagagacaaaagttctcgaagccgaactggagccgcattcgcgc
gaggaacacttgccgctcgcaagtgatcccgttttatcggaggagttggataccccgggc
ggcccggctgcggacgctgtcgagccttccgaagacgccgaagagtcggcgatccttccg
agcgcctaccagattggcgatcttggagtgataccactctcgttgctggaggctgaggct
gaagccgagccagagacgtcagcccaagacgcgcccttggcggagacacccccctcagtc
ccttcgggacatttcccccacgaggggaaagatcagttggccgacgaggcgccactttcc
gacgcttctcgtgatgaagtcacggatattcgtccggagatttccgggacggctgaggga
gggcaaagcgctcctgctcaaccaacctctctccttgtaggggagatgcccggcaaggtg
gagggggatgctcctcgacctgaagcggatggcgagcatgcttcaaggacggaacctgtc
cttcccaagggctttgcaaccactccgaaaatcaccgaaccggagccgattgttcctgcg
ccgaaactcagctggttccagcgtctgcgcgccggtctcgcacgtacttcgtcgcaactc
acgggccagatttcagcgctcttcaccaagcgcaagctggacgacgacacccttcaggat
ctcgaagaccttctgatacaggccgacctcggcgtcgagaccgccatgcgtgtcaccgat
acgcttgcttccgagcgctatggcaaggatgtgaccggcgaggatgtcagccgcatcatg
gcgtcggaaattgccaaagtgctgaagccggtcgcaaggcccttgcagctcgatctcacc
cacaagccgcatgtcattctcgtcgtcggcgtcaacggcaccggcaagacgacgacgatc
ggcaagctggcgtcgaagctttcgggtgccgggttgaaggtcatggtggcggcgggcgat
acgttccgcgccgcggcgatcgagcagttgaagatctgggccgatcgcacgaagtcggaa
ttcatcggcaccaagcttggcgcggatgccgcaggtctcgcctacgacgccttcgagcag
gcgaaggcgaaaaagtgcgacgtgctgatcatcgataccgccggccgtttgcaaaacaag
gccgagttgatggcggagcttgaaaagatcgtccgcgtgctcggcaagctcgatcccgac
gccccgcatacggtgctgcagacgctggatgcgaccaccggccagaacgctctcaatcag
gtcgaaatcttccgcaatgttgcgggcgtcaacggtctgatcatgaccaagctcgatggt
acggcaaggggcggcatcctcgttgcgatctccgccaagcacaagctaccggtctatttc
atcggcgtcggcgaaggcgtagacgatctggagccgttcgaggccgaggatttcgctcaa
gccattgccgggcttgggcaatga
DBGET
integrated database retrieval system