Rhizobium gallicum bv. gallicum: RGR602_PC00631 Help Entry RGR602_PC00631    CDS       T03539                                  Name (GenBank) DNA-binding HU-like protein   KO K03530   DNA-binding protein HU-beta Organism rga  Rhizobium gallicum bv. gallicum Brite KEGG Orthology (KO) [BR:rga00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rga03032]     RGR602_PC00631    03036 Chromosome and associated proteins [BR:rga03036]     RGR602_PC00631    03400 DNA repair and recombination proteins [BR:rga03400]     RGR602_PC00631 DNA replication proteins [BR:rga03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RGR602_PC00631 Chromosome and associated proteins [BR:rga03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RGR602_PC00631 DNA repair and recombination proteins [BR:rga03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RGR602_PC00631 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AJD44669 UniProt:  A0A0B4X9J4 LinkDB All DBs Position pRgalR602c:complement(669955..670233) Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIAGEHGLTKAQSKAVVEAVFASITSAATSGAETSIPGFGKFKIKETPERE GRNPSTGATVKIAAAKKLAFTPAKAVKDALNK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgacgacaaacgaaatcgcagacaagatcgccggtgaacatggccttaccaaagcc cagagcaaggccgttgtagaggcggtcttcgcctcgattacgtcggccgccacatctggc gccgagacctcgatcccgggcttcggcaagttcaagataaaggagacgccggagcgcgaa ggccgcaatccctcaaccggagccaccgtcaagatcgctgccgcaaagaagctcgccttc acgccggccaaggcagtgaaggatgctcttaacaagtga

DBGET integrated database retrieval system