Rubrivivax gelatinosus: RGE_11700 Help Entry RGE_11700         CDS       T01803                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rge  Rubrivivax gelatinosus Brite KEGG Orthology (KO) [BR:rge00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rge03036]     RGE_11700    03400 DNA repair and recombination proteins [BR:rge03400]     RGE_11700 Chromosome and associated proteins [BR:rge03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RGE_11700 DNA repair and recombination proteins [BR:rge03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RGE_11700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  BAL94511 UniProt:  I0HNC4 LinkDB All DBs Position 1225096..1225410 Genome browser AA seq 104 aa AA seqDB search MPTYAQLQERIAQLQTQAEALKRAERADVVAQTRRVIAQWALTPQELFGRAAPSSEPKYR DAQGRVWGGRGPRPHWLREAIAAGARLEDFLIDDGAEAPRRKRA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgccgacttatgcgcagttgcaggagcgcatcgcgcaactgcagacccaggccgaagcc ttgaagcgtgccgagcgtgccgacgtcgtcgcgcagacgcgccgtgtcatcgcccaatgg gcgttgacgccgcaggagctgttcggccgcgccgcacccagcagcgagcccaagtaccgc gacgcgcaagggcgggtctggggcgggcgcggcccgcggccgcactggctgcgtgaagcc atcgccgccggcgcgcggctcgaggacttcctcatcgacgacggcgccgaggcgccgcgc cgcaagcgcgcctga

DBGET integrated database retrieval system