Rubrivivax gelatinosus: RGE_27020 Help Entry RGE_27020         CDS       T01803                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rge  Rubrivivax gelatinosus Brite KEGG Orthology (KO) [BR:rge00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rge03036]     RGE_27020    03400 DNA repair and recombination proteins [BR:rge03400]     RGE_27020 Chromosome and associated proteins [BR:rge03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RGE_27020 DNA repair and recombination proteins [BR:rge03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RGE_27020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N DUF2786 YL1_C KELAA Tet_C_40 Motif Other DBs NCBI-ProteinID:  BAL96041 UniProt:  I0HSQ4 LinkDB All DBs Position 2859193..2859501 Genome browser AA seq 102 aa AA seqDB search MATLSELLAQKAALEKQIIETQREERAAAIAQVKSLMSQYGLTLADLSAKSGAATPRRGS TGKVPAKYRDPDTGDTWSGRGLQPKWLKAALANGRSLSDFTV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctacgttgtccgaattgctcgcacagaaggctgcactcgaaaagcagatcatcgag acgcaacgcgaggaacgcgctgcggcgatcgcccaggtgaagtcgctgatgtcgcagtac ggactgacgctggccgacctgagcgccaagtccggcgccgcgacgccgcgccgcggcagc accggcaaggtgcctgccaagtaccgtgacccggacaccggcgacacctggtccggccgc ggtctgcagccgaagtggctgaaggcggcgctggccaatggccggtcgctgtccgatttc accgtctaa

DBGET integrated database retrieval system