Roseomonas gilardii: RGI145_11280 Help Entry RGI145_11280      CDS       T04615                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rgi  Roseomonas gilardii Pathway rgi00998   Biosynthesis of various antibiotics rgi01100   Metabolic pathways rgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RGI145_11280    00074 Mycolic acid biosynthesis     RGI145_11280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RGI145_11280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DnaT_2 Motif Other DBs NCBI-ProteinID:  APT57600 UniProt:  A0A1L7AFV7 LinkDB All DBs Position 1:2487874..2488113 Genome browser AA seq 79 aa AA seqDB search MSETADKVKKIVVEHLGVEESKVNEGASFIDDLGADSLDTVELVMAFEEAFGVEIPDDAA EKITTVGDAIKYIEEHKTA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgccgacaaggtgaagaagatcgttgtcgagcacctgggcgtcgaggag tccaaggtgaacgagggcgcctccttcatcgacgacctgggcgccgacagcctcgacacc gtcgagctggtgatggccttcgaggaggctttcggcgtcgagatccccgacgacgcggcc gagaagatcaccaccgtcggtgacgccatcaagtacatcgaggagcacaagaccgcctga

DBGET integrated database retrieval system