Roseomonas gilardii: RGI145_14405 Help Entry RGI145_14405      CDS       T04615                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rgi  Roseomonas gilardii Pathway rgi00998   Biosynthesis of various antibiotics rgi01100   Metabolic pathways rgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RGI145_14405    00074 Mycolic acid biosynthesis     RGI145_14405   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RGI145_14405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  APT58123 UniProt:  A0A1L7AH55 LinkDB All DBs Position 1:complement(3155862..3156119) Genome browser AA seq 85 aa AA seqDB search MMAGTVEAGLAARFETVLRRAFPGFRGAFHEGLTAADVAGWDSVAHVNLLMDLEDAFGVE IPPEAAAQVPDVGGLMALVRERLPG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgatggctggaaccgtggaggccgggctggccgcgcgtttcgagacggtgctgcgccgg gccttcccaggcttccgcggcgccttccacgaagggctgaccgccgccgacgtggccggt tgggattcggtcgcgcatgtgaacctgctgatggacctggaggacgccttcggcgtcgag atcccgccggaagcggcggcgcaggtgccggatgtgggcgggctgatggcgctggtgcgg gagcgcctgcccgggtga

DBGET integrated database retrieval system