Roseomonas gilardii: RGI145_20105 Help Entry RGI145_20105      CDS       T04615                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rgi  Roseomonas gilardii Pathway rgi00998   Biosynthesis of various antibiotics rgi01100   Metabolic pathways rgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RGI145_20105    00074 Mycolic acid biosynthesis     RGI145_20105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RGI145_20105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  APT59640 UniProt:  A0A1L7ALK7 LinkDB All DBs Position 2:151491..151742 Genome browser AA seq 83 aa AA seqDB search MLDEQAALREITAALDETGKLTGPITMDTNILKDLNFDSVGAVDFIMVLETRLDIIIPMD RMTEIETIGDLVRVVTSDPSLAS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctggatgagcaggccgccctacgggaaataaccgcggccctggacgagacggggaag ctgacgggccccatcactatggatacgaacatcctcaaggacctgaacttcgactccgtg ggcgcggtcgatttcatcatggtgctggagacccgcctggacatcatcatcccgatggac cggatgacggagattgagaccatcggcgacctcgtccgggtcgtgaccagcgatcccagc ctggcctcctga

DBGET integrated database retrieval system