Roseomonas gilardii: RGI145_21335 Help Entry RGI145_21335      CDS       T04615                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rgi  Roseomonas gilardii Pathway rgi00998   Biosynthesis of various antibiotics rgi01100   Metabolic pathways rgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RGI145_21335    00074 Mycolic acid biosynthesis     RGI145_21335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RGI145_21335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APT59852 UniProt:  A0A1L7AM40 LinkDB All DBs Position 2:complement(430531..430779) Genome browser AA seq 82 aa AA seqDB search MESEVAALIVEALHLEMSAEDIDPEAPLFRTGLGLDSIDALEIALAISQRYGCQLRSDDE RNHQIFASLRHLTAYIQQNRTR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggagtccgaggtggcggcactgatcgtcgaggcactccatctggagatgtccgccgag gacatcgatccggaagcccccctgttcagaacagggctaggcctggattccatcgatgct ctggaaatagccctggcgatttcccagcgttacggctgtcagctgcgctcggacgacgag cgcaaccatcagatcttcgcctcactgcgtcacctgacggcctatatccagcaaaaccgg acacgctag

DBGET integrated database retrieval system