Rhodanobacter glycinis: CS053_02155 Help Entry CS053_02155       CDS       T06136                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rgl  Rhodanobacter glycinis Pathway rgl01100   Metabolic pathways rgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CS053_02155    00074 Mycolic acid biosynthesis     CS053_02155   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CS053_02155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEE23434 UniProt:  A0A1I4B157 LinkDB All DBs Position 536025..536297 Genome browser AA seq 90 aa AA seqDB search MAEQTAAQHELAALIVDCLNLEGVDPAGIDPDAPLFGSGELGLDSIDALEIALAVSKRYG FALRSDNPDNQRVFASLRSLSDYVEQQRAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagactgccgcgcagcacgaattggctgccctgatcgtggattgtctcaat ctggaaggcgtcgacccggccggaatcgacccggatgcgccgctgttcggcagtggcgaa ctggggctggattcgatcgacgccctggaaatcgcgttggcggtttccaagcgctacggc ttcgcgttgcgttcggacaatccggacaaccagcgcgtgttcgccagcctgcgcagcctg tccgattacgtcgagcagcagcgcgcggcgtga

DBGET integrated database retrieval system