Rhodanobacter glycinis: CS053_06470 Help Entry CS053_06470       CDS       T06136                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rgl  Rhodanobacter glycinis Pathway rgl01100   Metabolic pathways rgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CS053_06470    00074 Mycolic acid biosynthesis     CS053_06470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CS053_06470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Raf1_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEE26349 UniProt:  A0A5B9E3Q6 LinkDB All DBs Position complement(1529536..1529781) Genome browser AA seq 81 aa AA seqDB search MSDAEILGRLREVLHETFEIAPARVTPSAHLFTDLELDSIDAVDLAIQVQEMTGMRIKPE DFKNVRTVGDVIATVHALLGR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atcagcgacgcggagattctgggcagactccgcgaagtgctgcacgagaccttcgagatc gcccctgcccgggtcacgccttcagcccacttgttcaccgacctggagctggactccatc gatgcggtggacctggccatccaggtgcaggaaatgaccggcatgcggatcaagccggaa gacttcaagaacgtgcgcaccgtcggcgacgtgatcgccacggtccatgccctgctcggc cgctga

DBGET integrated database retrieval system