Rhodococcus globerulus: KYT97_07455 Help Entry KYT97_07455       CDS       T07544                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rgo  Rhodococcus globerulus Brite KEGG Orthology (KO) [BR:rgo00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     KYT97_07455 Enzymes [BR:rgo01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      KYT97_07455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_2 GST_N_3 Redoxin Motif Other DBs NCBI-ProteinID:  QXW05399 LinkDB All DBs Position 1660609..1660875 Genome browser AA seq 88 aa AA seqDB search MCAVTTSEKAPALTIYSTTWCGYCRRLKTQLNASGIEYTEIDIENDPSAAEFVGSVNDGN HIVPTVKYADGSVATNPSLNQVKQALGL NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atatgcgccgtgactacttccgaaaaagctcctgccctcaccatctactcgaccacgtgg tgcggctactgccgccgcctcaagacccagctcaacgcgtcgggcatcgagtacaccgaa atcgacatcgagaacgatccgtcggcagccgaatttgtcggcagcgtcaacgacggcaat cacatcgtcccgacggtgaagtacgccgacggaagtgtcgcgaccaacccgtcgctcaat caggtgaagcaggccctcggactgtag

DBGET integrated database retrieval system