Rhodococcus gordoniae: NMQ04_14140 Help Entry NMQ04_14140       CDS       T08682                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rgor  Rhodococcus gordoniae Brite KEGG Orthology (KO) [BR:rgor00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NMQ04_14140 Enzymes [BR:rgor01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      NMQ04_14140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  UTT47405 LinkDB All DBs Position 3048295..3048549 Genome browser AA seq 84 aa AA seqDB search MTTTDAPALTVYSTTWCGYCRRLKTQLDQNGIAYTEVDIESDPAAAEFVGSVNNGNHVVP TVKFTDGSTATNPSLAEVQRALGL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaccgatgcacccgccctcaccgtctactccaccacctggtgcggttactgc aggcggctgaagacccagctcgaccagaacggcatcgcgtacaccgaggtcgacatcgaa tcggatccggccgccgcggagttcgtcggcagcgtcaacaacggcaaccacgtggtgccc accgtcaagttcaccgacggcagcaccgccaccaacccgtcgctcgccgaggtccagcgc gctctggggctgtag

DBGET integrated database retrieval system