Rhizobium grahamii: FZ934_03795 Help Entry FZ934_03795       CDS       T06285                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rgr  Rhizobium grahamii Pathway rgr01100   Metabolic pathways rgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FZ934_03795    00074 Mycolic acid biosynthesis     FZ934_03795   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FZ934_03795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  QFY59630 UniProt:  A0A370KTJ6 LinkDB All DBs Position 750826..751062 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgacgcc gacaaggttgtcgaaggcgcaagcttcatcgacgatctgggcgctgactcgctcgacacc gtcgaactggtcatggcgttcgaagaagaattcggcgttgaaattcctgatgacgctgca gactcgatcctgacggtcggcgatgctgtaaagtttatcgaaaaggctcaggcttaa

DBGET integrated database retrieval system