Piscinibacter gummiphilus: A4W93_16535 Help Entry A4W93_16535       CDS       T04831                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism rgu  Piscinibacter gummiphilus Brite KEGG Orthology (KO) [BR:rgu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rgu03032]     A4W93_16535    03036 Chromosome and associated proteins [BR:rgu03036]     A4W93_16535    03400 DNA repair and recombination proteins [BR:rgu03400]     A4W93_16535 DNA replication proteins [BR:rgu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A4W93_16535 Chromosome and associated proteins [BR:rgu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A4W93_16535 DNA repair and recombination proteins [BR:rgu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A4W93_16535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 UBA_HYPK Motif Other DBs NCBI-ProteinID:  ARN21373 UniProt:  A0A1W6LAV5 LinkDB All DBs Position complement(3687926..3688198) Genome browser AA seq 90 aa AA seqDB search MNKSELIEHIAKQADISKAAATRALEALIGGVKSTLKKNNSVSLVGFGTFSVTKRAARAG RNPRTGAAIKIKAAKVPKFRPGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaatccgaattgattgagcacattgccaagcaagccgacatttcgaaagctgcg gcaacgcgcgcgctggaagccctgatcggtggtgtgaaatcaacactcaagaaaaacaac agcgtctcgctggtgggtttcggaaccttcagcgtcacgaagcgcgccgcgcgcgccggc cgcaacccgcgcacgggtgccgccatcaagatcaaggcagccaaggtgccgaagttccgt ccgggcaaggccctcaaggacgcgctgaactga

DBGET integrated database retrieval system