Rhizobacter gummiphilus: A4W93_20010 Help Entry A4W93_20010       CDS       T04831                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rgu  Rhizobacter gummiphilus Pathway rgu00362   Benzoate degradation rgu00621   Dioxin degradation rgu00622   Xylene degradation rgu01100   Metabolic pathways rgu01120   Microbial metabolism in diverse environments rgu01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:rgu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A4W93_20010    00622 Xylene degradation     A4W93_20010    00621 Dioxin degradation     A4W93_20010 Enzymes [BR:rgu01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      A4W93_20010 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  ARN21997 UniProt:  A0A1W6LCQ6 LinkDB All DBs Position 4430281..4430511 Genome browser AA seq 76 aa AA seqDB search MPYVNIQVTREGTSPGASATTPEQKRALIQGVSQLLLDVMGKPLASTFVVIEEVDLENWG VGGLPVQEFRAGSKVP NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccgtacgtcaacatccaggtgacccgagaaggcacctcccccggcgcgagcgccacc acgcccgagcagaagcgtgccctcatccagggcgtcagccagctgctgctcgacgtgatg ggcaagccgctcgcctcgacgttcgtcgtgatcgaagaggtcgacctcgagaactggggc gtcggcggcctgccggtgcaggagttccgggccgggagcaaggtgccatga

DBGET integrated database retrieval system