Rhodococcus jostii: RHA1_ro03879 Help Entry RHA1_ro03879      CDS       T00382                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rha  Rhodococcus jostii Pathway rha00362   Benzoate degradation rha00621   Dioxin degradation rha00622   Xylene degradation rha01100   Metabolic pathways rha01120   Microbial metabolism in diverse environments rha01220   Degradation of aromatic compounds Module rha_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:rha00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     RHA1_ro03879    00622 Xylene degradation     RHA1_ro03879    00621 Dioxin degradation     RHA1_ro03879 Enzymes [BR:rha01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      RHA1_ro03879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 MDMPI_C eCIS_core Peptidase_M27 Motif Other DBs NCBI-ProteinID:  ABG95679 UniProt:  Q0S9V7 LinkDB All DBs Position complement(4085101..4085337) Genome browser AA seq 78 aa AA seqDB search MPIIEVTIAEGRSPEELRLLIHELTHAAHRAVGTPVANVRVILRETPKTHFAAGDVTLAE REEAANIRVSGTAADVGT NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgccgatcatcgaggtcaccatcgccgagggccgcagccccgaggaactgcgcctgctg atccacgagctcacccacgccgctcaccgggcggtggggacgcccgtcgcgaacgtccgt gtgatcctgcgcgagacaccgaagacgcacttcgcggccggcgacgtcacgctcgccgag cgggaggaagcggcgaacatccgggtatccggaacggccgccgacgtcggcacctga

DBGET integrated database retrieval system