KEGG   Rhodococcus jostii: RHA1_ro05297
Entry
RHA1_ro05297      CDS       T00382                                 

Definition
(GenBank) probable amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
rha  Rhodococcus jostii
Pathway
rha00240  Pyrimidine metabolism
rha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RHA1_ro05297
Enzymes [BR:rha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     RHA1_ro05297
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: ABG97078
UniProt: Q0S5V8
LinkDB
Position
5641401..5642903
AA seq 500 aa
MSHVIDPVTVGDSGPRPGASCQPREYGELVMCDALTLSSAIKSREVSCIDVMTAYLDHIE
LHNRSVNAIVALRDRDQLLAEARERDRQLADGHYLGWMHGFPHAVKDLSAVKGLPFTSGS
PIFADRIADADDLFVTRIRAAGAIIIGKTNTPEFGLGSQTYNPVWGTTATPYDTSRTAGG
SSGGAAAALALRMVPVADGSDYMGSLRNPPAFNNVVGFRPSWGRIPEAGFVAQGAVVGPM
GRSVADVTHLLSTMAGPDANAPLGIDEDPEVFTRSLDRDFSGTRIAWVGDWGGYMATEPG
VLELCESAFEAFGNIGCRVEAALPDYKPEDIWQLFLRWRWWAQLGLVDLYNDPQTRAQMK
PEFVWEMEHGIALSALDVTRAAAARNDWQAAVTKMFETYDYILAPSAQVFPFDKATHWPT
TIAGRPMDTYHRWMETVAPWTMASLPVAAMPVGFDDRGLPMGIQIIGRHGADRAVLQLAH
AYEQATKWVERVLPPALLPG
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtcacacgtcatcgaccccgtcaccgtcggcgattccggccctcgcccgggagcctcg
tgccagccgcgcgaatacggagagctcgtcatgtgtgacgcgctgacgctcagtagtgcg
atcaagagccgcgaggtgtcgtgcatcgacgtgatgaccgcctatctcgaccacatcgaa
ttgcacaatcgcagtgtcaacgccattgtcgccctgcgtgaccgggaccagttgcttgcc
gaggcgcgcgagcgggaccgccaactggccgacgggcactacctcggctggatgcacggg
ttcccgcacgccgtcaaggacctctccgcggtcaagggattaccgttcacctcgggatca
ccgatctttgccgaccggatcgccgacgcggacgacctgttcgtcacgcggatcagggca
gccggtgccatcatcatcggcaagaccaacacccccgagttcggactcggatcccaaacg
tacaacccggtctgggggacgacggcgacaccgtacgacacctcacgcaccgccggtgga
agcagcggcggcgctgctgcggccctggcgttgcggatggttccggttgccgacggcagt
gactacatgggctcgctgcgtaatccgccggccttcaataatgttgtgggatttcgcccg
tcgtggggccgcatcccggaggccggattcgtcgcgcagggtgcggttgtcggtccgatg
gggcggtcggtggctgatgtgacgcacctgctgtccacgatggcgggtcccgacgccaac
gccccgctgggcatcgacgaggaccccgaggtattcacccggagcctcgaccgtgacttc
agcgggactcggatcgcgtgggtaggggactggggcgggtacatggcgacggaacccgga
gtcctcgaactgtgcgagtccgcattcgaggcgttcgggaacatcggttgccgcgtcgag
gcggcgctccccgactacaagcccgaggacatttggcagctgtttctgaggtggcgctgg
tgggcgcaactcggcttggtcgacctctacaacgacccgcagacacgcgcgcagatgaag
cccgagttcgtgtgggagatggagcacggaatcgctctctccgcgctcgacgtcaccagg
gctgcggcggcacgcaacgactggcaggcggccgtcacgaagatgttcgaaacctatgac
tacatcctcgcgcccagtgcgcaggtgtttccgttcgacaaggccacacactggcccacg
acgatcgcgggccggccgatggatacctatcaccggtggatggagaccgtcgcaccgtgg
acgatggcgagtcttccggttgctgcgatgccggtcggtttcgatgaccgcgggcttccc
atgggaatccagatcattggacgacacggcgcagaccgggccgttctccaactcgcccac
gcgtacgagcaggcaacgaagtgggtggagcgtgtgcttccgcccgcgctcctcccgggc
tga

DBGET integrated database retrieval system