Rhodococcus jostii: RHA1_ro06380 Help Entry RHA1_ro06380      CDS       T00382                                  Name (GenBank) possible glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rha  Rhodococcus jostii Brite KEGG Orthology (KO) [BR:rha00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     RHA1_ro06380 Enzymes [BR:rha01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      RHA1_ro06380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_2 GST_N_3 Motif Other DBs NCBI-ProteinID:  ABG98157 UniProt:  Q0S2S9 LinkDB All DBs Position complement(6876455..6876709) Genome browser AA seq 84 aa AA seqDB search MTATDTPALTIYSTTWCGYCRRLKTQLDESGIGYLEIDIEDDPASAEFVGSVNGGNHVVP TVKFADGSTATNPSLAQVKQLLGA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgactgctaccgacacccccgccctgaccatctactccaccacctggtgcggctactgc cggcgcctgaagacccagctggacgaatccggcatcggctacttggagatcgacatcgag gacgacccggcatcggcggagttcgtcggcagcgtcaacggcggcaaccatgtcgtcccc accgtcaagttcgccgacggcagcaccgcgaccaacccgtcgttggcgcaggtcaagcag ctcctcggcgcctag

DBGET integrated database retrieval system