KEGG   Rhodococcus jostii: RHA1_ro08055
Entry
RHA1_ro08055      CDS       T00382                                 

Gene name
bphC1
Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
rha  Rhodococcus jostii
Pathway
rha00361  Chlorocyclohexane and chlorobenzene degradation
rha00621  Dioxin degradation
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    RHA1_ro08055 (bphC1)
   00621 Dioxin degradation
    RHA1_ro08055 (bphC1)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     RHA1_ro08055 (bphC1)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3
Other DBs
NCBI-ProteinID: ABG99102
UniProt: Q0S034
LinkDB
Position
pRHL1:complement(52635..53588)
AA seq 317 aa
MSVQRLGYMGFEVADVPAWRAFMTEKLGAMEASSSENSARFRVDSRSWRLMVEKGPSDDI
SLSGYEVDSADSLLAIKKRLEAHGIEVTTESGELAADRGVLGLISCTDTANTRVEIYYGA
TELFEKPFISPTGVSGFTTGDQGFGHYVLAVPDIDAALDFYVKGLGFHLSDIIDWKLNDE
LTVKLHFLHCNGRHHTLALAGLPGAKKTHHFMLETKHMDDVGLAYDKFDADGTVVMTLGR
HTNDHMLSFYGATPSGFAVEYGWGARQVEPGWSVVRYDKISIWGHKFVAERDRQVSSNAI
EDELIDIDATLSAPAQA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagcgttcagagactcggttacatgggcttcgaggttgcggatgtgcccgcgtggcgc
gccttcatgacggaaaaactgggggccatggaggcctcgagcagcgagaattcggcgcgg
ttcagggttgactcccgcagttggcgcctgatggtcgaaaagggcccgtcggatgacatc
tcgctctcgggctacgaggtcgatagcgcggactcgctactcgcgatcaagaagcgtctc
gaagcgcatggcatcgaggtgacaacagagagcggcgagttggcggccgatcgcggtgtc
ctcggactgatttcgtgcacggacacggcaaacacccgggtcgagatctactatggcgcg
acggagctgttcgagaagccgttcatctcgccgaccggggtctcgggcttcacaaccggc
gaccaggggttcggccactacgtgctggctgtgccggatatagatgctgccctggatttc
tatgtcaagggcctgggcttccatctctccgacatcatcgactggaagctcaacgatgaa
ctgacggtcaaactccacttcctgcactgcaacggtcgacaccacaccctggcgctcgcc
ggtctcccgggagcaaagaagactcaccacttcatgctcgagaccaagcatatggatgac
gtgggccttgcctacgacaagttcgatgcggacgggacagtggtcatgacgcttggccgc
cacaccaatgaccacatgctctcattctacggcgcgaccccctccggatttgccgtcgaa
tacggctggggcgctcgccaggtcgaaccaggctggtccgtcgtgcgctacgacaagatc
agcatctggggtcacaaattcgttgccgagcgcgacaggcaagtgagcagcaacgcaatc
gaggatgaattgattgacatcgatgccacgctgagcgccccggcgcaagcgtaa

DBGET integrated database retrieval system